SitesBLAST
Comparing WP_035242470.1 NCBI__GCF_000745975.1:WP_035242470.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q51742 Ornithine carbamoyltransferase, anabolic; OTCase; EC 2.1.3.3 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 3 papers)
49% identity, 99% coverage: 3:304/306 of query aligns to 8:311/315 of Q51742
- W22 (≠ T17) mutation to A: Decreased heat stability.
- E26 (= E21) mutation to Q: Increased dissociation of dodecamers into trimers.
- M30 (≠ S25) mutation to A: Increased dissociation of dodecamers into trimers.
- W34 (≠ R29) mutation to A: Increased dissociation of dodecamers into trimers.
- Y228 (= Y220) mutation to C: Becomes active at low temperatures; when associated with G-278.
- A241 (≠ L233) mutation to D: Becomes active at low temperatures; when associated with G-278.
- E278 (= E270) mutation to G: Becomes active at low temperatures; when associated with C-228 or D-241.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
8qeuA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with ornithine (see paper)
44% identity, 98% coverage: 3:302/306 of query aligns to 2:302/304 of 8qeuA
Q81M99 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Bacillus anthracis
44% identity, 98% coverage: 3:301/306 of query aligns to 12:308/316 of Q81M99
- STRT 57:60 (= STRT 52:55) binding carbamoyl phosphate
- Q84 (= Q79) binding carbamoyl phosphate
- R108 (= R103) binding carbamoyl phosphate
- HPCQ 135:138 (= HPCQ 130:133) binding carbamoyl phosphate
- N166 (= N161) binding L-ornithine
- D230 (= D222) binding L-ornithine
- SM 234:235 (= SM 226:227) binding L-ornithine
- CL 269:270 (= CL 262:263) binding carbamoyl phosphate
- R297 (≠ K290) binding carbamoyl phosphate
4nf2A Crystal structure of anabolic ornithine carbamoyltransferase from bacillus anthracis in complex with carbamoyl phosphate and l- norvaline
44% identity, 98% coverage: 3:302/306 of query aligns to 8:305/307 of 4nf2A
- active site: R55 (= R54), T56 (= T55), R83 (= R82), R104 (= R103), H131 (= H130), Q134 (= Q133), D226 (= D222), C265 (= C262), R293 (≠ K290)
- binding phosphoric acid mono(formamide)ester: S53 (= S52), T54 (= T53), R55 (= R54), T56 (= T55), R104 (= R103), H131 (= H130), Q134 (= Q133), C265 (= C262), L266 (= L263), R293 (≠ K290)
- binding norvaline: L126 (= L125), N162 (= N161), D226 (= D222), S230 (= S226), M231 (= M227)
8qevA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with carbamoyl phosphate (see paper)
43% identity, 98% coverage: 3:302/306 of query aligns to 2:295/297 of 8qevA
2i6uA Crystal structure of ornithine carbamoyltransferase complexed with carbamoyl phosphate and l-norvaline from mycobacterium tuberculosis (rv1656) at 2.2 a (see paper)
44% identity, 96% coverage: 10:302/306 of query aligns to 10:304/307 of 2i6uA
- active site: R52 (= R54), T53 (= T55), R80 (= R82), R101 (= R103), H128 (= H130), Q131 (= Q133), D224 (= D222), C264 (= C262), R292 (≠ K290)
- binding phosphoric acid mono(formamide)ester: S50 (= S52), T51 (= T53), R52 (= R54), T53 (= T55), R101 (= R103), C264 (= C262), L265 (= L263), R292 (≠ K290)
- binding norvaline: L123 (= L125), N160 (= N161), D224 (= D222), S228 (= S226), M229 (= M227)
7nouA Crystal structure of mycobacterium tuberculosis argf in complex with (3,5-dichlorophenyl)boronic acid.
44% identity, 96% coverage: 10:302/306 of query aligns to 11:305/308 of 7nouA
- active site: R102 (= R103), H129 (= H130), Q132 (= Q133), D225 (= D222), C265 (= C262), R293 (≠ K290)
- binding [3,5-bis(chloranyl)phenyl]-oxidanyl-oxidanylidene-boron: I46 (= I47), T52 (= T53), R53 (= R54), R53 (= R54), F56 (≠ I57), F56 (≠ I57), L79 (≠ I80), D82 (≠ N83), E83 (= E84), V91 (= V92), Y95 (= Y96), L266 (= L263), R293 (≠ K290)
7nosA Crystal structure of mycobacterium tuberculosis argf in complex with 4-bromo-6-(trifluoromethyl)-1h-benzo[d]imidazole.
44% identity, 96% coverage: 10:302/306 of query aligns to 11:305/308 of 7nosA
7norA Crystal structure of mycobacterium tuberculosis argf in complex with 2-fluoro-4-hydroxybenzonitrile.
44% identity, 96% coverage: 10:302/306 of query aligns to 11:305/308 of 7norA
7nnyA Crystal structure of mycobacterium tuberculosis argf in complex with naphthalen-1-ol.
44% identity, 96% coverage: 10:302/306 of query aligns to 11:305/308 of 7nnyA
- active site: R102 (= R103), H129 (= H130), Q132 (= Q133), D225 (= D222), C265 (= C262), R293 (≠ K290)
- binding 1-naphthol: T52 (= T53), R53 (= R54), F56 (≠ I57), E83 (= E84), V91 (= V92), Y95 (= Y96)
7nnwA Crystal structure of mycobacterium tuberculosis argf in complex with methyl 4-hydroxy-3-iodobenzoate.
44% identity, 96% coverage: 10:302/306 of query aligns to 11:305/308 of 7nnwA
- active site: R102 (= R103), H129 (= H130), Q132 (= Q133), D225 (= D222), C265 (= C262), R293 (≠ K290)
- binding methyl 3-iodanyl-4-oxidanyl-benzoate: I46 (= I47), T52 (= T53), R53 (= R54), F56 (≠ I57), L79 (≠ I80), L92 (= L93), Y95 (= Y96)
7nnvA Crystal structure of mycobacterium tuberculosis argf in complex with carbamoyl phosphate.
44% identity, 96% coverage: 10:302/306 of query aligns to 11:305/308 of 7nnvA
- active site: R102 (= R103), H129 (= H130), Q132 (= Q133), D225 (= D222), C265 (= C262), R293 (≠ K290)
- binding phosphoric acid mono(formamide)ester: S51 (= S52), T52 (= T53), R53 (= R54), T54 (= T55), R102 (= R103), H129 (= H130), C265 (= C262), L266 (= L263), R293 (≠ K290)
P9WIT9 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
44% identity, 96% coverage: 10:302/306 of query aligns to 10:304/307 of P9WIT9
- STRT 50:53 (= STRT 52:55) binding carbamoyl phosphate
- Q77 (= Q79) binding carbamoyl phosphate
- R101 (= R103) binding carbamoyl phosphate
- HPCQ 128:131 (= HPCQ 130:133) binding carbamoyl phosphate
- N160 (= N161) binding L-ornithine
- D224 (= D222) binding L-ornithine
- SM 228:229 (= SM 226:227) binding L-ornithine
- CL 264:265 (= CL 262:263) binding carbamoyl phosphate
- R292 (≠ K290) binding carbamoyl phosphate
7np0A Crystal structure of mycobacterium tuberculosis argf in complex with (4-nitrophenyl)boronic acid.
43% identity, 96% coverage: 10:302/306 of query aligns to 11:302/305 of 7np0A
P00481 Ornithine transcarbamylase, mitochondrial; OTCase; Ornithine carbamoyltransferase, mitochondrial; EC 2.1.3.3 from Rattus norvegicus (Rat) (see 2 papers)
39% identity, 98% coverage: 3:302/306 of query aligns to 40:342/354 of P00481
- R92 (= R54) mutation to L: Strong decrease in ornithine carbamoyltransferase activity.
- C303 (= C262) mutation to S: Increases KM for ornithine 5-fold and decreases kcat 20-fold.
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
7novA Crystal structure of mycobacterium tuberculosis argf in complex with (4-methyl-3-nitrophenyl)boronic acid.
43% identity, 96% coverage: 10:302/306 of query aligns to 11:299/302 of 7novA
- active site: R96 (= R103), H123 (= H130), Q126 (= Q133), D219 (= D222), C259 (= C262), R287 (≠ K290)
- binding (4-methyl-3-nitro-phenyl)-oxidanyl-oxidanylidene-boron: R53 (= R54), F56 (≠ I57), E77 (= E84), V85 (= V92), Y89 (= Y96), L260 (= L263), A284 (= A287), R287 (≠ K290)
7nnzB Crystal structure of mycobacterium tuberculosis argf in complex with 5-methyl-4-phenylthiazol-2-amine.
42% identity, 96% coverage: 10:302/306 of query aligns to 10:294/297 of 7nnzB
P00480 Ornithine transcarbamylase, mitochondrial; OTCase; Ornithine carbamoyltransferase, mitochondrial; EC 2.1.3.3 from Homo sapiens (Human) (see 31 papers)
38% identity, 98% coverage: 3:302/306 of query aligns to 40:342/354 of P00480
- R40 (≠ K3) to H: in OTCD; late onset; dbSNP:rs72554308
- L43 (= L6) to F: in dbSNP:rs72554309
- K46 (≠ L9) to R: in dbSNP:rs1800321
- Y55 (≠ T18) to D: in OTCD; late onset; dbSNP:rs72554319
- L63 (= L26) to P: in OTCD; late onset; dbSNP:rs72554324
- K88 (= K50) modified: N6-acetyllysine; alternate; to N: in OTCD; late onset; dbSNP:rs72554339
- STRT 90:93 (= STRT 52:55) binding carbamoyl phosphate
- G100 (≠ A62) to D: in OTCD; late onset; dbSNP:rs72554349
- F101 (≠ M63) to L: in dbSNP:rs1133135
- L111 (≠ M73) to P: in dbSNP:rs1800324
- T125 (≠ K87) to M: in OTCD; neonatal; dbSNP:rs72554356
- D126 (= D88) to G: in OTCD; early onset; loss of ornithine carbamoyltransferase activity; 0.9% of wild-type activity; dbSNP:rs72554358
- R129 (= R91) to H: in OTCD; early onset; decreased ornithine carbamoyltransferase activity; 2.1% of wild-type activity; dbSNP:rs66656800
- A140 (≠ M102) to P: in OTCD; late onset; dbSNP:rs72556260
- R141 (= R103) binding carbamoyl phosphate; to Q: in OTCD; most common variant; loss of ornithine carbamoyltransferase activity; activity is 100-fold lower; dbSNP:rs68026851
- H168 (= H130) binding carbamoyl phosphate
- Q171 (= Q133) binding carbamoyl phosphate
- I172 (= I134) to M: in OTCD; early onset; loss of ornithine carbamoyltransferase activity; dbSNP:rs72556280
- Y176 (≠ I138) to C: in OTCD; late onset; dbSNP:rs72556283
- TL 178:179 (≠ TV 140:141) natural variant: Missing (in OTCD; neonatal)
- Y183 (≠ K145) to D: in OTCD; late onset; dbSNP:rs72556292
- G188 (≠ D150) to R: in OTCD; neonatal; dbSNP:rs72556294
- G195 (= G157) to R: in OTCD; loss of ornithine carbamoyltransferase activity; dbSNP:rs67294955
- D196 (= D158) to V: in OTCD; neonatal; decreased ornithine carbamoyltransferase activity; 3.7% activity; dbSNP:rs72556300
- L201 (≠ A163) to P: in OTCD; neonatal; dbSNP:rs72558407
- S207 (≠ A169) to R: in OTCD; neonatal; dbSNP:rs72558415
- A209 (≠ S171) to V: in OTCD; neonatal; dbSNP:rs72558417
- M213 (≠ L175) to K: in OTCD; late onset
- H214 (≠ D176) to Y: in OTCD; neonatal; dbSNP:rs72558420
- P220 (= P182) to A: in OTCD; late onset; dbSNP:rs72558425
- P225 (≠ I187) to T: in OTCD; late onset; dbSNP:rs72558428
- L244 (≠ I203) to Q: in OTCD; late onset; dbSNP:rs72558436
- T262 (= T221) to K: in OTCD; mild; dbSNP:rs67333670
- T264 (≠ V223) to A: in OTCD; late onset; decreased ornithine carbamoyltransferase activity; 8.9% activity; dbSNP:rs72558444; to I: in OTCD; late onset; dbSNP:rs67156896
- W265 (= W224) to L: in OTCD; mild; dbSNP:rs72558446
- G269 (= G228) to E: in OTCD; neonatal; dbSNP:rs72558450
- Q270 (≠ E229) to R: in dbSNP:rs1800328
- E272 (≠ D231) natural variant: Missing (in OTCD; late onset; dbSNP:rs72558452)
- R277 (= R236) to Q: in OTCD; late onset; dbSNP:rs66724222; to W: in OTCD; late onset; dbSNP:rs72558454
- H302 (= H261) to L: in OTCD; female; late onset; dbSNP:rs67993095; to Y: in OTCD; neonatal; dbSNP:rs72558463
- C303 (= C262) to R: in OTCD; neonatal; dbSNP:rs67468335
- CL 303:304 (= CL 262:263) binding carbamoyl phosphate
- E309 (= E269) natural variant: Missing (in OTCD; late onset)
- R330 (≠ K290) binding carbamoyl phosphate
- T333 (≠ M293) natural variant: T -> A
- S340 (≠ R300) to P: in OTCD; late onset; dbSNP:rs72558489
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
- 15 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-23 and G-26.
- 23 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-15 and G-26.
- 26 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-15 and G-23.
- 39 G → C: in OTCD; late onset; dbSNP:rs72554306
- 343 T → K: in OTCD; late onset; dbSNP:rs72558491
1othA Crystal structure of human ornithine transcarbamoylase complexed with n-phosphonacetyl-l-ornithine (see paper)
38% identity, 98% coverage: 3:302/306 of query aligns to 7:309/321 of 1othA
- active site: R59 (= R54), T60 (= T55), V87 (≠ R82), R108 (= R103), H135 (= H130), Q138 (= Q133), D230 (= D222), C270 (= C262), R297 (≠ K290)
- binding n-(phosphonoacetyl)-l-ornithine: S57 (= S52), T58 (= T53), R59 (= R54), T60 (= T55), R108 (= R103), L130 (= L125), H135 (= H130), N166 (= N161), D230 (= D222), S234 (= S226), M235 (= M227), C270 (= C262), L271 (= L263), R297 (≠ K290)
1c9yA Human ornithine transcarbamylase: crystallographic insights into substrate recognition and catalytic mechanism (see paper)
38% identity, 98% coverage: 3:302/306 of query aligns to 7:309/321 of 1c9yA
- active site: R59 (= R54), T60 (= T55), V87 (≠ R82), R108 (= R103), H135 (= H130), Q138 (= Q133), D230 (= D222), C270 (= C262), R297 (≠ K290)
- binding phosphoric acid mono(formamide)ester: S57 (= S52), T58 (= T53), R59 (= R54), T60 (= T55), R108 (= R103), C270 (= C262), L271 (= L263), R297 (≠ K290)
- binding norvaline: L130 (= L125), N166 (= N161), D230 (= D222), S234 (= S226), M235 (= M227)
Query Sequence
>WP_035242470.1 NCBI__GCF_000745975.1:WP_035242470.1
MKKDLLCLLDLEPQDFTTLFERALSLKARHKKGIFDSLLAGKTLGLIFDKKSTRTRIAFE
TAMIQLGGHSIYMSTQDTQISRNEPAKDTARVLSRYIDCLAMRTFDHDLVEAFAQSATIP
VINALTDAFHPCQILSDIMTVIEHKGGYEDVRIAWVGDGNNVANSWVNAASVLGLDLIVA
CPDNHHINPEIIAAAGADTKENIVFTNDPKEAIKGADVVYTDVWASMGEEDQLEGRLKAF
KGFQVNEELLKSAKDDCLVLHCLPAHRGEEIAESVLEAQNAAFWDQAENKRHMHKAILER
LILGRD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory