SitesBLAST
Comparing WP_035242625.1 NCBI__GCF_000745975.1:WP_035242625.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P05041 Aminodeoxychorismate synthase component 1; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 1; EC 2.6.1.85 from Escherichia coli (strain K12) (see 4 papers)
36% identity, 60% coverage: 25:472/749 of query aligns to 19:453/453 of P05041
- S36 (= S42) binding
- E258 (= E277) mutation to A: The reaction is extremely slow.; mutation to D: The reaction is extremely slow.
- K274 (= K293) mutation to A: Absence of covalent intermediate. Addition of ammonia allows the formation of the covalent intermediate and shows that ammonia can replace the function of K-274. Reduced catalytic efficiency.; mutation to R: Absence of covalent intermediate.; mutation to R: Reduced catalytic efficiency.
- G275 (= G294) mutation to S: Catalytically inactive for both the glutamine-dependent and ammonia-dependent reactions and fails to interact with PabA.
- R311 (= R330) mutation to K: Catalytically active in the NH3-dependent, but inactive for the glutamine-dependent reactions and fails to complex with PabA.
- R316 (= R335) mutation to H: Catalytically inactive for both the glutamine-dependent and ammonia-dependent reactions and fails to interact with PabA.
- S322 (= S341) mutation to T: Complete loss of aminodeoxychorismate synthase activity.
- H339 (= H358) mutation to W: Catalytically inactive for both the glutamine-dependent and ammonia-dependent reactions and fails to interact with PabA.
1k0eA The crystal structure of aminodeoxychorismate synthase from formate grown crystals (see paper)
36% identity, 60% coverage: 25:472/749 of query aligns to 17:437/437 of 1k0eA
- active site: E256 (= E277), K272 (= K293), E286 (= E321), H323 (= H358), S350 (= S385), W374 (≠ Y409), R394 (= R429), G410 (= G445), E423 (= E458), K427 (= K462)
- binding tryptophan: L32 (= L40), H33 (≠ L41), S34 (= S42), Y41 (≠ C48), F44 (≠ Y51), P238 (= P259), F239 (= F260), S240 (≠ F261)
P28820 Aminodeoxychorismate synthase component 1; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 1; EC 2.6.1.85 from Bacillus subtilis (strain 168) (see paper)
33% identity, 56% coverage: 49:470/749 of query aligns to 41:460/470 of P28820
- A283 (≠ K293) mutation to I: Complete loss of aminodeoxychorismate synthase activity.; mutation to K: Absence of covalent intermediate.; mutation to V: Complete loss of aminodeoxychorismate synthase activity.
7pi1DDD Aminodeoxychorismate synthase component 1
34% identity, 56% coverage: 49:470/749 of query aligns to 39:453/459 of 7pi1DDD
Sites not aligning to the query:
1k0gA The crystal structure of aminodeoxychorismate synthase from phosphate grown crystals (see paper)
34% identity, 60% coverage: 25:472/749 of query aligns to 19:420/420 of 1k0gA
- active site: E258 (= E277), K274 (= K293), E278 (= E321), S333 (= S385), W357 (≠ Y409), R377 (= R429), G393 (= G445), E406 (= E458), K410 (= K462)
- binding phosphate ion: D113 (= D122), R116 (≠ D125), D347 (= D399), R353 (≠ K405)
- binding tryptophan: L34 (= L40), H35 (≠ L41), S36 (= S42), Y43 (≠ C48), S44 (≠ A49), F46 (≠ Y51), P240 (= P259), F241 (= F260), S242 (≠ F261)
1k0gB The crystal structure of aminodeoxychorismate synthase from phosphate grown crystals (see paper)
34% identity, 60% coverage: 25:470/749 of query aligns to 19:415/415 of 1k0gB
- active site: E258 (= E277), K274 (= K293), E277 (= E321), S330 (= S385), W354 (≠ Y409), R374 (= R429), G390 (= G445), E403 (= E458), K407 (= K462)
- binding phosphate ion: Y112 (= Y121), D113 (= D122), R116 (≠ D125), D344 (= D399), R350 (≠ K405)
- binding tryptophan: L34 (= L40), H35 (≠ L41), S36 (= S42), Y43 (≠ C48), S44 (≠ A49), R45 (= R50), F46 (≠ Y51), P240 (= P259), F241 (= F260)
8hx8A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate (see paper)
38% identity, 48% coverage: 114:470/749 of query aligns to 308:670/673 of 8hx8A
Sites not aligning to the query:
8hx9A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae with chorismate (see paper)
38% identity, 48% coverage: 114:470/749 of query aligns to 266:631/632 of 8hx9A
- binding (3R,4R)-3-[(1-carboxyethenyl)oxy]-4-hydroxycyclohexa-1,5-diene-1-carboxylic acid: I453 (= I292), K454 (= K293), G455 (= G294), T456 (= T295), M547 (≠ I386), Y570 (= Y409), R590 (= R429), V603 (= V442), G604 (= G443), G605 (= G444), A606 (≠ G445), E619 (= E458), K623 (= K462)
- binding tryptophan: P419 (= P259), Y420 (≠ F260), G421 (≠ F261), L574 (≠ I413), G575 (= G414)
Sites not aligning to the query:
A0QX93 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
31% identity, 61% coverage: 14:468/749 of query aligns to 44:513/524 of A0QX93
- K355 (≠ G310) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
7bvdA Anthranilate synthase component i (trpe)[mycolicibacterium smegmatis]
30% identity, 61% coverage: 14:468/749 of query aligns to 24:488/499 of 7bvdA
- active site: Q248 (= Q230), E301 (= E277), A317 (≠ K293), E341 (= E321), H378 (= H358), T405 (≠ S385), Y429 (= Y409), R449 (= R429), G465 (= G445), E478 (= E458), K482 (= K462)
- binding pyruvic acid: S93 (≠ F90), G94 (vs. gap), A100 (≠ T95)
Q94GF1 Anthranilate synthase alpha subunit 1, chloroplastic; OsASA1; EC 4.1.3.27 from Oryza sativa subsp. japonica (Rice) (see paper)
31% identity, 56% coverage: 47:466/749 of query aligns to 108:563/577 of Q94GF1
- D323 (= D244) mutation to N: Insensitive to feedback inhibition by tryptophan.
5cwaA Structure of anthranilate synthase component i (trpe) from mycobacterium tuberculosis with inhibitor bound (see paper)
30% identity, 54% coverage: 64:468/749 of query aligns to 68:492/505 of 5cwaA
- active site: Q248 (= Q230), E301 (= E277), A317 (≠ K293), E345 (= E321), H382 (= H358), T409 (≠ S385), Y433 (= Y409), R453 (= R429), G469 (= G445), E482 (= E458), K486 (= K462)
- binding 3-{[(1Z)-1-carboxyprop-1-en-1-yl]oxy}-2-hydroxybenzoic acid: Y433 (= Y409), I452 (= I428), A466 (≠ V442), G467 (= G443), K486 (= K462)
O94582 Probable anthranilate synthase component 1; Anthranilate synthase component I; EC 4.1.3.27 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
40% identity, 34% coverage: 212:462/749 of query aligns to 215:466/489 of O94582
- S390 (≠ T387) modified: Phosphoserine
- S392 (≠ C389) modified: Phosphoserine
Sites not aligning to the query:
- 488 modified: Phosphoserine
P32068 Anthranilate synthase alpha subunit 1, chloroplastic; Anthranilate synthase component 1-1; Anthranilate synthase component I-1; Protein A-METHYL TRYPTOPHAN RESISTANT 1; Protein JASMONATE-INDUCED DEFECTIVE LATERAL ROOT 1; Protein TRYPTOPHAN BIOSYNTHESIS 5; Protein WEAK ETHYLENE INSENSITIVE 2; EC 4.1.3.27 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 56% coverage: 50:466/749 of query aligns to 127:581/595 of P32068
- D341 (= D244) mutation to N: In trp5-1; insensitive to feedback inhibition by tryptophan and resistance to the herbicide 6-methylanthranilate.
P00898 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
32% identity, 47% coverage: 117:471/749 of query aligns to 148:511/520 of P00898
- C174 (= C143) mutation to Y: Almost no change in feedback control by tryptophan.
- N288 (= N256) mutation to D: Decrease in feedback control by tryptophan.
- P289 (= P257) mutation to L: Decrease in feedback control by tryptophan.
- M293 (≠ F261) mutation to T: Complete loss of feedback control by tryptophan.
- F294 (≠ A262) mutation to L: Decrease in feedback control by tryptophan.
- G305 (≠ S273) mutation to S: Decrease in feedback control by tryptophan.
- R402 (≠ V362) mutation to W: Almost no change in feedback control by tryptophan.
- G460 (= G420) mutation to D: Almost no change in feedback control by tryptophan.
- C465 (≠ S425) mutation to Y: Complete loss of feedback control by tryptophan. 4-fold decrease of affinity binding for chorismate.
Sites not aligning to the query:
- 39 E→K: Complete loss of feedback control by tryptophan.
- 40 binding ; S→F: Complete loss of feedback control by tryptophan.
- 41 A→V: Decrease in feedback control by tryptophan.
- 50 binding
- 128 R→H: Almost no change in feedback control by tryptophan.
- 515 H→Y: Almost no change in feedback control by tryptophan.
1i1qA Structure of the cooperative allosteric anthranilate synthase from salmonella typhimurium (see paper)
32% identity, 47% coverage: 117:471/749 of query aligns to 144:507/512 of 1i1qA
- active site: Q259 (= Q230), E305 (= E277), A323 (≠ K293), E357 (= E321), H394 (= H358), T421 (≠ S385), Y445 (= Y409), R465 (= R429), G481 (= G445), E494 (= E458), K498 (= K462)
- binding tryptophan: P287 (= P259), Y288 (≠ F260), M289 (≠ F261), G450 (= G414), C461 (≠ S425)
Sites not aligning to the query:
1i7qA Anthranilate synthase from s. Marcescens (see paper)
32% identity, 50% coverage: 94:471/749 of query aligns to 122:508/517 of 1i7qA
- active site: Q260 (= Q230), E306 (= E277), A324 (≠ K293), E358 (= E321), H395 (= H358), T422 (≠ S385), Y446 (= Y409), R466 (= R429), G482 (= G445), E495 (= E458), K499 (= K462)
- binding magnesium ion: E358 (= E321), E495 (= E458)
- binding pyruvic acid: Y446 (= Y409), I465 (= I428), R466 (= R429), A479 (≠ V442), G480 (= G443), K499 (= K462)
1i7sA Anthranilate synthase from serratia marcescens in complex with its end product inhibitor l-tryptophan (see paper)
32% identity, 50% coverage: 94:471/749 of query aligns to 116:502/511 of 1i7sA
- active site: Q254 (= Q230), E300 (= E277), A318 (≠ K293), E352 (= E321), H389 (= H358), T416 (≠ S385), Y440 (= Y409), R460 (= R429), G476 (= G445), E489 (= E458), K493 (= K462)
- binding tryptophan: P282 (= P259), Y283 (≠ F260), M284 (≠ F261), V444 (≠ I413), G445 (= G414), D454 (= D423), C456 (≠ S425)
Sites not aligning to the query:
P00897 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Serratia marcescens (see paper)
32% identity, 51% coverage: 90:471/749 of query aligns to 123:510/519 of P00897
Sites not aligning to the query:
5jy9B An iron-bound structure of the salicylate synthase irp9 (see paper)
27% identity, 34% coverage: 212:462/749 of query aligns to 165:414/424 of 5jy9B
- active site: K183 (≠ Q230), E230 (= E277), A246 (≠ K293), E274 (= E321), H311 (= H358), T338 (≠ S385), Y362 (= Y409), R381 (= R429), G397 (= G445), E410 (= E458), K414 (= K462)
- binding fe (ii) ion: E274 (= E321), E410 (= E458)
Query Sequence
>WP_035242625.1 NCBI__GCF_000745975.1:WP_035242625.1
MSENFFLPRITDIVIRGLNFDLPFELAAARFSRQEGTVVLLSGSDLDCARYHILGADPWL
TLKGTGETICLNVKDSAGCFVCHETDQDPFDLVDTLVKKLSFLDKAFKLPVTAGLFGYFA
YDLKDRIENLPRTCVGNGLPDICLYAPSVVLIQDRKTCENWLCLPVFDRDKGQEDVLARE
EYFLKRLEQSWHPGAFCADGTGFVSSFAKPEYLSAVSQIIAHLRQGDIYQANLSQRFETG
FNGDAYALFLKLFEKNPAPFFAFIQAGDHQVVSTSPERFLKVEGSTVESRPIKGTISRGN
TPEQDRENAGTLSRSTKDDAELTMIVDLMRNDLSRITEHDSVDVTAHKRLEPYDNVFHLV
SVVRGRLKADVSCAGVVRAAFPGGSITGCPKIRAMEIIDALEPVKRHVYTGAIGYLSFHG
TMDLSIAIRTAVVHDGRLFFSVGGGVVYDSDPEKEFEETLAKGKTLMDTLAQGAGQHIEK
SIIAWVNGCFVPQDLARVPAGIPGFLYGAGLFETIRVDAGIPLRLPEHTRRLEQSWGAVF
GQSLPDICWESVVEQLISQNGFEQKICAVKLVAAKDERPGRHVFVAAFIRTYMHRLELLG
KKSLDLVVFPHARHSFLADHKSMNYLFYDLARAFALDHGADESLILNSDSTVSETNTCNI
MALDGKNMVIPASSHVLDGITLGCVIQIMAKKGFTINRVALDVERFCTLPYVFVTNALMG
MVPVRRIDNTMLNIDPLLCRQVNEILLSA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory