Comparing WP_035703549.1 NCBI__GCF_000691145.1:WP_035703549.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
1k6dB Crystal structure of acetate coa-transferase alpha subunit (see paper)
47% identity, 94% coverage: 2:216/228 of query aligns to 3:217/219 of 1k6dB
Q29551 Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial; SCOT; 3-oxoacid CoA-transferase 1; Somatic-type succinyl-CoA:3-oxoacid CoA-transferase; SCOT-s; Succinate-coenzyme A transferase; Succinyl-CoA:3-oxoacid CoA transferase; EC 2.8.3.5 from Sus scrofa (Pig) (see 3 papers)
37% identity, 90% coverage: 9:214/228 of query aligns to 48:271/520 of Q29551
Sites not aligning to the query:
1o9lA Succinate:coenzyme-a transferase (pig heart)
37% identity, 90% coverage: 9:214/228 of query aligns to 9:232/468 of 1o9lA
3k6mC Dynamic domains of succinyl-coa:3-ketoacid-coenzyme a transferase from pig heart. (see paper)
37% identity, 90% coverage: 9:214/228 of query aligns to 9:232/466 of 3k6mC
Sites not aligning to the query:
3oxoE Succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa (see paper)
37% identity, 90% coverage: 9:214/228 of query aligns to 9:232/462 of 3oxoE
Sites not aligning to the query:
8i3yD Crystal structure of asct from trypanosoma brucei in complex with succinyl-coa.
32% identity, 93% coverage: 1:213/228 of query aligns to 2:232/471 of 8i3yD
8i3yA Crystal structure of asct from trypanosoma brucei in complex with succinyl-coa.
32% identity, 93% coverage: 1:213/228 of query aligns to 2:232/459 of 8i3yA
Sites not aligning to the query:
8i40A Crystal structure of asct from trypanosoma brucei in complex with coa.
32% identity, 93% coverage: 1:213/228 of query aligns to 2:232/467 of 8i40A
Sites not aligning to the query:
2ahvA Crystal structure of acyl-coa transferase from e. Coli o157:h7 (ydif)- thioester complex with coa- 1 (see paper)
26% identity, 68% coverage: 59:213/228 of query aligns to 75:248/512 of 2ahvA
Sites not aligning to the query:
6co9A Crystal structure of rhodococcus jostii rha1 ipdab cochea-coa complex (see paper)
25% identity, 86% coverage: 2:197/228 of query aligns to 5:213/295 of 6co9A
Q0S7P9 Cholesterol ring-cleaving hydrolase IpdA subunit; (3E)-2-(2-carboxylatoethyl)-3-methyl-6-oxocyclohex-1-ene-1-carboxyl-CoA hydrolase alpha subunit; COCHEA-CoA hydrolase alpha subunit; EC 4.1.99.- from Rhodococcus jostii (strain RHA1) (see paper)
25% identity, 86% coverage: 2:197/228 of query aligns to 6:214/296 of Q0S7P9
>WP_035703549.1 NCBI__GCF_000691145.1:WP_035703549.1
MNKTVGLDEVMTRLKDGMTIMFGGFGGVGSPPSLIDAILEANIQDLTLIGNDAGFPQIGV
GRLITEGRVKKIIASHIGSNPIAGQKMQAGTLDVHFYPQGILAEKIRAGGMGLAGIVTDV
GMDSLNLDEKQLVQLNGKNYMLEPALTADIAIVNAYKADEVGNLIFDKSARNTNPIVAMA
GDWTIAEAEEIVGAGQLDPEEIVTPGVFVNQIVQSKGVNWTWAWETSI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory