Comparing WP_035854753.1 NCBI__GCF_000519045.1:WP_035854753.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
5yumA Crystallographic structures of ilvn.Val/ile complexes:conformational selectivity for feedback inhibition of ahass (see paper)
59% identity, 85% coverage: 15:102/103 of query aligns to 4:91/91 of 5yumA
5yppE Crystal structure of ilvn.Val-1a (see paper)
59% identity, 85% coverage: 15:102/103 of query aligns to 4:91/91 of 5yppE
2pc6A Crystal structure of putative acetolactate synthase- small subunit from nitrosomonas europaea (see paper)
38% identity, 69% coverage: 14:84/103 of query aligns to 3:74/164 of 2pc6A
P9WKJ3 Putative acetolactate synthase small subunit; Acetohydroxy-acid synthase small subunit; AHAS; ALS; EC 2.2.1.6 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 79% coverage: 17:97/103 of query aligns to 8:89/168 of P9WKJ3
A0QUX7 Acetolactate synthase small subunit; Acetohydroxy-acid synthase small subunit; AHAS; ALS; EC 2.2.1.6 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
33% identity, 79% coverage: 17:97/103 of query aligns to 10:91/170 of A0QUX7
Q9FFF4 Acetolactate synthase small subunit 2, chloroplastic; ALS-interacting protein 3; Acetohydroxy-acid synthase small subunit 2; Protein valine-tolerant 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 81% coverage: 16:98/103 of query aligns to 309:390/477 of Q9FFF4
Sites not aligning to the query:
Q93YZ7 Acetolactate synthase small subunit 1, chloroplastic; ALS-interacting protein 1; Acetohydroxyacid synthase small subunit 1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
29% identity, 92% coverage: 4:98/103 of query aligns to 309:402/491 of Q93YZ7
Sites not aligning to the query:
6vz8G Arabidopsis thaliana acetohydroxyacid synthase complex with valine bound (see paper)
31% identity, 80% coverage: 17:98/103 of query aligns to 6:86/159 of 6vz8G
>WP_035854753.1 NCBI__GCF_000519045.1:WP_035854753.1
MNALSQTERQTLSRAVLEIDVNNHAGVMSHVVGLFSRRAYNVEGILCLPLADSGQSRIWL
LVNEDQRLPQMIKQVEKLEDVAAIRRHNADHAVFQNLEAFFRA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory