SitesBLAST
Comparing WP_036259385.1 NCBI__GCF_000746085.1:WP_036259385.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6f34A Crystal structure of a bacterial cationic amino acid transporter (cat) homologue bound to arginine. (see paper)
50% identity, 98% coverage: 3:491/498 of query aligns to 2:457/458 of 6f34A
- binding arginine: I40 (= I48), G42 (= G50), T43 (≠ A51), G44 (= G52), E115 (= E123), Y116 (= Y124), A119 (≠ G127), F228 (= F262), A229 (= A263), I231 (= I265), V314 (= V348)
- binding cholesterol: W201 (≠ S221), Y202 (≠ S222)
- binding : G28 (≠ S36), F30 (≠ A38), D31 (≠ S39), M34 (≠ A42), A178 (= A198), R179 (= R199), A186 (≠ L206), I187 (= I207), A190 (= A210), L194 (= L214), Q296 (≠ L330), V299 (≠ L333)
5oqtA Crystal structure of a bacterial cationic amino acid transporter (cat) homologue (see paper)
50% identity, 98% coverage: 4:491/498 of query aligns to 1:455/456 of 5oqtA
- binding alanine: I38 (= I48), G40 (= G50), T41 (≠ A51), G42 (= G52), F226 (= F262), A227 (= A263), I229 (= I265)
- binding : E24 (≠ T34), G26 (≠ S36), F28 (≠ A38), D29 (≠ S39), M32 (≠ A42), A176 (= A198), R177 (= R199), A184 (≠ L206), A188 (= A210), L192 (= L214), Q294 (≠ L330), V297 (≠ L333)
P30825 High affinity cationic amino acid transporter 1; CAT-1; CAT1; Ecotropic retroviral leukemia receptor homolog; Ecotropic retrovirus receptor homolog; Solute carrier family 7 member 1; System Y+ basic amino acid transporter from Homo sapiens (Human) (see paper)
36% identity, 82% coverage: 27:434/498 of query aligns to 24:435/629 of P30825
- N226 (= N233) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q7YQK4 Large neutral amino acids transporter small subunit 1; 4F2 light chain; 4F2 LC; 4F2LC; L-type amino acid transporter 1; LAT1; Solute carrier family 7 member 5 from Oryctolagus cuniculus (Rabbit) (see 2 papers)
25% identity, 96% coverage: 7:483/498 of query aligns to 23:470/503 of Q7YQK4
- C88 (≠ A76) mutation to S: No significant effect on inhibition by HgCl(2). Decreased KM and Vmax for Phe. Similar affect on KM and Vmax for Phe; when associated with S-183.
- C98 (= C86) mutation to S: No significant effect on inhibition by HgCl(2). Slightly decreased KM and Vmax for Phe. Slightly less decreased KM and Vmax for Phe; when associated with S-183.
- C160 (≠ I150) mutation to S: No change to KM or Vmax for Phe.
- C172 (≠ D162) mutation to S: No change to KM or Vmax for Phe.
- C174 (≠ A164) mutation to S: No change to KM or Vmax for Phe.
- C183 (≠ A173) mutation to S: No significant effect on inhibition by HgCl(2). Slightly decreased KM and Vmax for Phe. Similar affect on KM and Vmax for Phe; when associated with S-88. Slightly less decreased KM and Vmax for Phe; when associated with S-98.
- G219 (≠ N227) mutation to D: Decreased KM and Vmax for Trp. Increased KM and Vmax for Phe; when associated with L-234.
- W234 (≠ L243) mutation to L: Decreased KM and Vmax for Trp. Increased KM but decreased Vmax for Phe. Increased KM and Vmax for Phe; when associated with D-219.
- C331 (≠ L345) mutation to S: No significant effect on inhibition by HgCl(2). Increased KM and Vmax for Phe.
- C377 (≠ G391) mutation to S: No significant effect on inhibition by HgCl(2).
- C403 (≠ A417) mutation to S: No significant effect on inhibition by HgCl(2).
- C439 (≠ P449) mutation to S: Prevents insertion into the plasma membrane and possibly protein folding.
- C454 (≠ T466) mutation to S: No significant effect on inhibition by HgCl(2). Slightly increased KM but slightly decreased Vmax for Phe.
Sites not aligning to the query:
- 492 C→S: No significant effect on inhibition by HgCl(2). Slightly decreased KM and Vmax for Phe.
Q01650 Large neutral amino acids transporter small subunit 1; 4F2 light chain; 4F2 LC; 4F2LC; CD98 light chain; Integral membrane protein E16; E16; L-type amino acid transporter 1; hLAT1; Solute carrier family 7 member 5; y+ system cationic amino acid transporter from Homo sapiens (Human) (see 3 papers)
25% identity, 95% coverage: 12:483/498 of query aligns to 26:474/507 of Q01650
- Y117 (= Y101) mutation to A: Strongly decreased leucine transport activity.
- C164 (≠ I150) modified: Interchain (with C-210 in SLC3A2)
- D223 (≠ N227) to V: in dbSNP:rs17853937
- N230 (≠ S235) to K: in dbSNP:rs1060250
- A246 (≠ G256) mutation to V: Nearly abolishes leucine transport activity.
- F252 (= F262) mutation to A: Nearly abolishes leucine transport activity.
- W257 (≠ F267) mutation to A: Nearly abolishes leucine transport activity.
- N258 (≠ D268) mutation to A: Decreased leucine transport activity.; mutation to D: Nearly abolishes leucine transport activity.
- Y259 (≠ A269) mutation to A: Strongly decreased leucine transport activity.
- E303 (≠ D313) mutation to K: Decreased leucine transport activity.
- P375 (≠ V385) mutation to L: Nearly abolishes leucine transport activity.
Sites not aligning to the query:
- 483:507 mutation Missing: Nearly abolishes leucine transport activity.
8xyjA Structure of y+lat1 bound with lys
27% identity, 93% coverage: 27:490/498 of query aligns to 1:438/459 of 8xyjA
8xxiA Structure of y+lat1 bound with leu
27% identity, 93% coverage: 27:490/498 of query aligns to 1:438/465 of 8xxiA
P76037 Putrescine importer PuuP from Escherichia coli (strain K12) (see paper)
25% identity, 93% coverage: 31:491/498 of query aligns to 18:448/461 of P76037
- Y110 (= Y124) mutation to X: The uptake activity is reduced to one-eighth of that of wild-type.
8j8mB Overall structure of the lat1-4f2hc bound with tryptophan
25% identity, 91% coverage: 31:483/498 of query aligns to 3:431/463 of 8j8mB
8j8lB Overall structure of the lat1-4f2hc bound with l-dopa
25% identity, 91% coverage: 31:483/498 of query aligns to 3:431/463 of 8j8lB
8x0wB Overall structure of the lat1-4f2hc bound with leu
25% identity, 91% coverage: 31:483/498 of query aligns to 3:431/464 of 8x0wB
8idaB Overall structure of the lat1-4f2hc bound with tyrosine
25% identity, 91% coverage: 31:483/498 of query aligns to 3:431/464 of 8idaB
7dsqB Overall structure of the lat1-4f2hc bound with 3,5-diiodo-l-tyrosine (see paper)
25% identity, 91% coverage: 31:483/498 of query aligns to 3:431/464 of 7dsqB
7dsnB Overall structure of the lat1-4f2hc bound with jx-119 (see paper)
25% identity, 91% coverage: 31:483/498 of query aligns to 3:431/464 of 7dsnB
- binding (2~{S})-2-azanyl-7-[[2-(1,3-benzoxazol-2-yl)phenyl]methoxy]-3,4-dihydro-1~{H}-naphthalene-2-carboxylic acid: T19 (≠ C47), I20 (= I48), G22 (= G50), S23 (≠ A51), G24 (= G52), I97 (≠ E123), I104 (≠ T130), F209 (= F262), A210 (= A263), G212 (≠ I265), I354 (≠ G407), N361 (≠ T414)
- binding cholesterol hemisuccinate: F109 (≠ W135), Y145 (≠ L174), K148 (≠ R195), V153 (= V200), Q326 (≠ R379)
Sites not aligning to the query:
7dslB Overall structure of the lat1-4f2hc bound with jx-078 (see paper)
25% identity, 91% coverage: 31:483/498 of query aligns to 3:431/464 of 7dslB
7dskB Overall structure of the lat1-4f2hc bound with jx-075 (see paper)
25% identity, 91% coverage: 31:483/498 of query aligns to 3:431/464 of 7dskB
- binding (2~{S})-2-azanyl-7-(naphthalen-1-ylmethoxy)-3,4-dihydro-1~{H}-naphthalene-2-carboxylic acid: T19 (≠ C47), I20 (= I48), S23 (≠ A51), G24 (= G52), I97 (≠ E123), S100 (≠ F126), S101 (≠ G127), F209 (= F262), G212 (≠ I265), Y216 (≠ A269), V353 (= V406), I354 (≠ G407), N361 (≠ T414)
- binding cholesterol hemisuccinate: K148 (≠ R195), A149 (≠ E196), V153 (= V200), F157 (≠ I204), H324 (= H377)
Sites not aligning to the query:
Q9QXW9 Large neutral amino acids transporter small subunit 2; L-type amino acid transporter 2; mLAT2; Solute carrier family 7 member 8 from Mus musculus (Mouse) (see paper)
26% identity, 93% coverage: 19:482/498 of query aligns to 23:463/531 of Q9QXW9
- Y130 (= Y124) mutation to A: Increases T2 import. Increases T3 and enables T4 import. Does not affect L-leucine and L-phenylalanine uptake.
- N133 (≠ G127) mutation to S: Increases T2 import. Does not affect T3 import. Does not affect L-leucine and L-phenylalanine uptake. Increases the export of both L-leucine and L-phenylalanine.
- F242 (= F262) mutation to W: Increases T2 import. Does not affect T3 import. Does not affect L-leucine and L-phenylalanine uptake.
Q9UHI5 Large neutral amino acids transporter small subunit 2; L-type amino acid transporter 2; hLAT2; Solute carrier family 7 member 8 from Homo sapiens (Human) (see 3 papers)
25% identity, 94% coverage: 14:482/498 of query aligns to 20:464/535 of Q9UHI5
- I53 (= I48) binding L-leucine
- Y93 (= Y87) mutation to A: Nearly complete reduction of glycine, L-alanine, and L-glutamine uptake. Minimal effect on the transport of L-isoleucine, L-histidine and L-tryptophan.
- N134 (≠ G127) Important for substrate specificity; binding L-tryptophan; mutation to Q: Reduces L-leucine uptake activity. Abolishes L-tryptophan uptake.; mutation to S: The substrate specificity changed dramatically reducing L-glutamine, glycine and L-alanine uptake activity thus mimicking the selectivity of SLC7A5.
- C154 (≠ A160) modified: Interchain (with C-210 in SLC3A2)
- W174 (≠ V188) mutation to A: Does not affect protein expression, plasma membrane localization, or L-alanine uptake.
- F243 (= F262) mutation to A: Abolishes leucine and tryptophan transport activities.
- G246 (≠ I265) Important for substrate specificity; binding L-leucine; mutation to S: Strong decrease in the uptake of large substrates L-tryptophan, L-glutamine, and L-histidine but increases the uptake of small neutral amino acids glycine and L-alanine.
- V302 (≠ I321) to I: found in a patient with age-related hearing loss; does not affect L-alanine transport activity. Decreases L-tyrosine transport activity; dbSNP:rs142951280
- N395 (≠ G413) binding L-tryptophan; mutation to Q: Strongly reduces L-leucine uptake activity. Strongly reduces L-tryptophan uptake activity.
- Y396 (≠ T414) mutation to A: Strongly reduces L-leucine uptake activity.
- T402 (≠ V421) to M: found in a patient with age-related hearing loss; strongly decreased L-alanine transport activity. Decreases L-tyrosine transport activity; dbSNP:rs758342760
- R418 (= R437) to C: found in a patient with age-related hearing loss; decreases L-alanine transport activity. Decreases L-tyrosine transport activity; dbSNP:rs146946494
- V460 (≠ L478) to E: found in a patient with age-related hearing loss; strongly decreases L-alanine transport activity. Decreases L-tyrosine transport activity. Decreases cell membrane localization; dbSNP:rs2048595742
6irtB Human lat1-4f2hc complex bound with bch (see paper)
24% identity, 90% coverage: 36:483/498 of query aligns to 1:424/457 of 6irtB
O34739 Serine/threonine exchanger SteT from Bacillus subtilis (strain 168) (see paper)
25% identity, 93% coverage: 26:490/498 of query aligns to 3:436/438 of O34739
- C94 (≠ I116) mutation to S: Retains 25% of the transport activity; when associated with S-141; S-168; S-291 and S-415.
- C141 (≠ T187) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-168; S-291 and S-415.
- C168 (≠ L214) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-141; S-291 and S-415.
- C291 (≠ V348) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-141; S-168 and S-415.
- C415 (≠ L470) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-141; S-168 and S-291.
Query Sequence
>WP_036259385.1 NCBI__GCF_000746085.1:WP_036259385.1
MTNIWARKSMAVLEAEANDAEFGAGSETAGLHRTLSLASVIALGIGCIIGAGIFVLTGHA
AASYAGPAVSLSFVLAGIVCAFAGLCYAEMASTVPVAGSAYTYAYATMGEFIAWIIGWDL
ILEYAFGATTVAIGWSGYVTSFLKDFDITIPAALASAPLAYDPANGDWTSTGALFNIPAA
FIIVLLTVLLVVGIRESARVNNAIVLIKLAIILLFIVAGVSSISAANWVTSTNPSGAFIP
PNLGPGQYGWSGIIRGAAVVFFAYIGFDAVSTAAQEAKNPQRDMPLGILGSLAICTVLYV
LVGVVITGVVPFDKLNVPDPIALGVDAIGLGWLSFLIKFGAILGLSSVILVLLLGQPRIF
YSMARDGLLPPFAAMVHPRFRTPYVTTILTGAIVAILSGLLPIGLVGELVSIGTLFAFTV
VCLGVLVLRITHPEIRRPFKTPFVFVVAPLGAASAIFLMFGLPSDTWLRLGIWLVIGLAI
YFFYGRQHSHLARHGSGQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory