Comparing WP_036833137.1 NCBI__GCF_000775615.1:WP_036833137.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
1sazA Membership in the askha superfamily: enzymological properties and crystal structure of butyrate kinase 2 from thermotoga maritima (see paper)
45% identity, 97% coverage: 4:357/365 of query aligns to 3:357/375 of 1sazA
1tuuA Acetate kinase crystallized with atpgs (see paper)
35% identity, 37% coverage: 174:307/365 of query aligns to 195:333/399 of 1tuuA
Sites not aligning to the query:
P38502 Acetate kinase; Acetokinase; EC 2.7.2.1 from Methanosarcina thermophila (see 5 papers)
35% identity, 37% coverage: 174:307/365 of query aligns to 195:333/408 of P38502
Sites not aligning to the query:
1tuuB Acetate kinase crystallized with atpgs (see paper)
35% identity, 37% coverage: 174:307/365 of query aligns to 195:333/398 of 1tuuB
Sites not aligning to the query:
4fwsA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with ctp (see paper)
32% identity, 45% coverage: 158:323/365 of query aligns to 172:342/394 of 4fwsA
Sites not aligning to the query:
4fwrA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with cmp (see paper)
32% identity, 45% coverage: 158:323/365 of query aligns to 172:342/394 of 4fwrA
Sites not aligning to the query:
4fwqA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with gtp (see paper)
32% identity, 45% coverage: 158:323/365 of query aligns to 172:342/394 of 4fwqA
Sites not aligning to the query:
4fwpA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with gdp (see paper)
32% identity, 45% coverage: 158:323/365 of query aligns to 172:342/394 of 4fwpA
Sites not aligning to the query:
4fwoA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with gmp (see paper)
32% identity, 45% coverage: 158:323/365 of query aligns to 172:342/394 of 4fwoA
Sites not aligning to the query:
4fwnA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with adenosine tetraphosphate (ap4) (see paper)
32% identity, 45% coverage: 158:323/365 of query aligns to 172:342/394 of 4fwnA
Sites not aligning to the query:
4fwmA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with atp (see paper)
32% identity, 45% coverage: 158:323/365 of query aligns to 172:342/394 of 4fwmA
Sites not aligning to the query:
4fwkA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with amp (see paper)
32% identity, 45% coverage: 158:323/365 of query aligns to 172:342/394 of 4fwkA
Sites not aligning to the query:
2e1zA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with diadenosine tetraphosphate (ap4a) obtained after co- crystallization with atp (see paper)
32% identity, 45% coverage: 158:323/365 of query aligns to 172:342/394 of 2e1zA
Sites not aligning to the query:
1x3nA Crystal structure of amppnp bound propionate kinase (tdcd) from salmonella typhimurium (see paper)
32% identity, 45% coverage: 158:323/365 of query aligns to 172:342/394 of 1x3nA
Sites not aligning to the query:
1x3mA Crystal structure of adp bound propionate kinase (tdcd) from salmonella typhimurium (see paper)
32% identity, 45% coverage: 158:323/365 of query aligns to 172:342/394 of 1x3mA
Sites not aligning to the query:
7fj9A Kpacka (pduw) with amppnp complex structure
31% identity, 37% coverage: 172:306/365 of query aligns to 191:330/395 of 7fj9A
Sites not aligning to the query:
7fj8A Kpacka (pduw) with amp complex structure
31% identity, 37% coverage: 172:306/365 of query aligns to 191:330/395 of 7fj8A
Sites not aligning to the query:
4iz9A Crystal structure of an acetate kinase from mycobacterium avium bound to an unknown acid-apcpp conjugate and manganese (see paper)
29% identity, 47% coverage: 174:345/365 of query aligns to 178:351/381 of 4iz9A
Sites not aligning to the query:
4ijnA Crystal structure of an acetate kinase from mycobacterium smegmatis bound to amp and sulfate (see paper)
31% identity, 36% coverage: 174:306/365 of query aligns to 176:312/376 of 4ijnA
Sites not aligning to the query:
>WP_036833137.1 NCBI__GCF_000775615.1:WP_036833137.1
MKHRVLAINPGATSTKVACYENDELTFKKEFTYHYETISQYDSIMQQYHLRYQDIATFLQ
EMDMKIGSFDAVVGRGGLLPPVKAGAYRVNEAMLDCLEHRPVLQHASNLGASLAKGIAEV
FGTEDCQAFIYDPVTVDQMEDVARISGSASIERKSIGHVLNMRAVSMKIADEQLGKPYEE
SRLVVAHIGGGSSASAHRNGRIIDLVSDDEGLFSTERSGGLPLKEIIPMCFQRTQKEMTE
LTRKKGGLVSYFGTNDARIVEEKAKNGDEQAQLILRAMAYQIAKTIGELATVLCGKVDAI
ILTGGLAYSEYVMNMVKERVSFLAPVHIVPGEEELLALAKGARRVLTGQEHAHTFIENEA
IVASK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory