Comparing WP_037060439.1 NCBI__GCF_900100495.1:WP_037060439.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8do5B Crystal structure of nahe in complex with intermediate (r)-4-hydroxy- 4-(2-hydroxyphenyl)-2-iminobutanoate (see paper)
93% identity, 96% coverage: 10:331/334 of query aligns to 3:324/324 of 8do5B
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
30% identity, 50% coverage: 16:183/334 of query aligns to 2:161/291 of 4dxvA
Sites not aligning to the query:
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
30% identity, 50% coverage: 16:183/334 of query aligns to 2:161/291 of 3u8gA
Sites not aligning to the query:
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
30% identity, 50% coverage: 16:183/334 of query aligns to 2:161/291 of 3tdfA
Sites not aligning to the query:
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
30% identity, 50% coverage: 16:183/334 of query aligns to 2:161/291 of 3tceA
Sites not aligning to the query:
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
30% identity, 50% coverage: 16:183/334 of query aligns to 2:161/291 of 3rk8A
Sites not aligning to the query:
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
30% identity, 50% coverage: 16:183/334 of query aligns to 2:161/291 of 3pueB
Sites not aligning to the query:
5c55A Crystal structure of the y138f mutant of c.Glutamicum n- acetylneuraminic acid lyase in complex with pyruvate
25% identity, 49% coverage: 22:183/334 of query aligns to 5:154/307 of 5c55A
Sites not aligning to the query:
3s8hA Structure of dihydrodipicolinate synthase complexed with 3- hydroxypropanoic acid(hpa)at 2.70 a resolution
33% identity, 43% coverage: 40:183/334 of query aligns to 19:161/292 of 3s8hA
Sites not aligning to the query:
3puoA Crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa(psdhdps)complexed with l-lysine at 2.65a resolution (see paper)
33% identity, 43% coverage: 40:183/334 of query aligns to 19:161/292 of 3puoA
Sites not aligning to the query:
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
28% identity, 36% coverage: 29:147/334 of query aligns to 9:127/298 of 4ptnA
Sites not aligning to the query:
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
28% identity, 36% coverage: 29:147/334 of query aligns to 9:127/298 of 4onvA
Sites not aligning to the query:
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
28% identity, 36% coverage: 29:147/334 of query aligns to 9:127/298 of 4oe7D
Sites not aligning to the query:
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
28% identity, 36% coverage: 29:147/334 of query aligns to 9:127/298 of 4oe7B
Sites not aligning to the query:
4oe7A Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
28% identity, 36% coverage: 29:147/334 of query aligns to 9:127/298 of 4oe7A
Sites not aligning to the query:
3nevA Crystal structure of yage, a prophage protein from e. Coli k12 in complex with kdgal (see paper)
28% identity, 36% coverage: 29:147/334 of query aligns to 9:127/298 of 3nevA
Sites not aligning to the query:
7mjfA Crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
25% identity, 74% coverage: 23:269/334 of query aligns to 9:245/296 of 7mjfA
Sites not aligning to the query:
7lvlA Dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
25% identity, 74% coverage: 23:269/334 of query aligns to 9:245/296 of 7lvlA
5ktlA Dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. (see paper)
26% identity, 43% coverage: 15:158/334 of query aligns to 4:140/295 of 5ktlA
Sites not aligning to the query:
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
28% identity, 41% coverage: 47:183/334 of query aligns to 27:162/293 of 5t25A
Sites not aligning to the query:
>WP_037060439.1 NCBI__GCF_900100495.1:WP_037060439.1
MSNKTMKPARLTAEDIHGVWAIMPTPATPDASNWRSTNTVDLNETARIVEELIAAGVNGI
LSMGTFGECATLTWEEKRDYVSTVVETIRGRVPYFCGTTALNTREVIRQTREFMDMGASG
TMLGVPMWVKMDLPTAVQFYRDVAEAVPEAAIAIYANPEAFKFDFPRPFWAEMSKIPQVV
TAKYLGIGMLDLDLKLAPNIRFLPHEDDYYAAARINPERMTAFWSSGSMCGPATAIMLRD
AVDQAKSSGDWIKAKAISDDMRAADSTLFPRGDFSEFSKYNIGLEKARMDAAGWLTAGPC
RPPYNIVPEDYIAGALKSGKAWAALHAKYSKELK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory