Comparing WP_037152734.1 NCBI__GCF_000359745.1:WP_037152734.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
31% identity, 88% coverage: 11:282/308 of query aligns to 10:288/313 of P94529
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
27% identity, 86% coverage: 21:286/308 of query aligns to 4:265/285 of 7cagA
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
27% identity, 74% coverage: 66:292/308 of query aligns to 259:501/514 of P02916
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
27% identity, 73% coverage: 67:292/308 of query aligns to 245:486/490 of 4ki0F
>WP_037152734.1 NCBI__GCF_000359745.1:WP_037152734.1
MLGKHTDMIARPRPRSRKWFRGEGWTALFFLLPGLIGIVLFLVLPILASIALSFTNWQLL
GTPRFVGFSNYLRLFTTDPQFWTVLRNTLFFTVEYLVLNIVISLGLATWISSLKIGQRWF
RVIFFLPTFTPLIAVAMVWMLIFTSGGLFDNLMAALSLPFSGVLNDRALAMQAVVLTSIW
AGVGYNTVLFNAALDMVPATYLEAARIDGATAWDRFWKIRLPLISPTLFFGTVMTAITSL
QVFDQIFVMTKGGPGSSTATLGYAIYQRGFQNFQMGYASAIAWVMFALIMALTALQFWFQ
RKWVHYDA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory