SitesBLAST
Comparing WP_037454055.1 NCBI__GCF_000576635.1:WP_037454055.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5v6qB Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and malonate (see paper)
53% identity, 97% coverage: 1:315/325 of query aligns to 1:313/319 of 5v6qB
- active site: L96 (= L100), R230 (= R232), D254 (= D256), E259 (= E261), H277 (= H279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V72 (= V76), V100 (= V104), F148 (≠ L150), L150 (= L152), G151 (= G153), R152 (= R154), I153 (= I155), T172 (≠ G174), R173 (= R175), V201 (≠ L203), P202 (= P204), S206 (≠ A208), T207 (= T209), V228 (= V230), G229 (= G231), R230 (= R232), H277 (= H279), A279 (= A281)
5v7nA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and 2-keto-d-gluconic acid (see paper)
53% identity, 97% coverage: 2:315/325 of query aligns to 1:312/319 of 5v7nA
- active site: L95 (= L100), R229 (= R232), D253 (= D256), E258 (= E261), H276 (= H279)
- binding 2-keto-D-gluconic acid: G70 (= G75), V71 (= V76), G72 (= G77), R229 (= R232), H276 (= H279), S279 (= S282), R285 (= R288)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V71 (= V76), V99 (= V104), L149 (= L152), G150 (= G153), R151 (= R154), I152 (= I155), T171 (≠ G174), R172 (= R175), V200 (≠ L203), P201 (= P204), S205 (≠ A208), T206 (= T209), V227 (= V230), G228 (= G231), R229 (= R232), H276 (= H279), A278 (= A281)
5v7gA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
53% identity, 96% coverage: 3:315/325 of query aligns to 1:311/317 of 5v7gA
- active site: L94 (= L100), R228 (= R232), D252 (= D256), E257 (= E261), H275 (= H279)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V70 (= V76), V98 (= V104), F146 (≠ L150), L148 (= L152), G149 (= G153), R150 (= R154), I151 (= I155), T170 (≠ G174), R171 (= R175), V199 (≠ L203), P200 (= P204), S204 (≠ A208), T205 (= T209), V226 (= V230), G227 (= G231), R228 (= R232), H275 (= H279), A277 (= A281)
- binding oxalate ion: G69 (= G75), V70 (= V76), G71 (= G77), R228 (= R232), H275 (= H279)
5j23A Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with 2'-phospho-adp-ribose (see paper)
53% identity, 96% coverage: 3:315/325 of query aligns to 1:311/318 of 5j23A
- active site: L94 (= L100), R228 (= R232), D252 (= D256), E257 (= E261), H275 (= H279)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4r,5r)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: V70 (= V76), L148 (= L152), G149 (= G153), R150 (= R154), I151 (= I155), T170 (≠ G174), R171 (= R175), P200 (= P204), S204 (≠ A208), T205 (= T209), R228 (= R232)
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
46% identity, 94% coverage: 6:312/325 of query aligns to 4:310/311 of 3bazA
- active site: L98 (= L100), R230 (= R232), A251 (= A253), D254 (= D256), E259 (= E261), H277 (= H279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (= V76), G149 (= G151), L150 (= L152), G151 (= G153), R152 (= R154), I153 (= I155), S172 (≠ G174), R173 (= R175), S174 (≠ H176), C201 (≠ L203), P202 (= P204), T207 (= T209), I228 (≠ V230), G229 (= G231), R230 (= R232), D254 (= D256), H277 (= H279), G279 (≠ A281)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
46% identity, 94% coverage: 6:312/325 of query aligns to 6:312/313 of Q65CJ7
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
38% identity, 78% coverage: 57:311/325 of query aligns to 57:318/334 of 5aovA
- active site: L100 (= L100), R241 (= R232), D265 (= D256), E270 (= E261), H288 (= H279)
- binding glyoxylic acid: Y74 (≠ F74), A75 (≠ G75), V76 (= V76), G77 (= G77), R241 (= R232), H288 (= H279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V76), T104 (≠ V104), F158 (≠ L152), G159 (= G153), R160 (= R154), I161 (= I155), S180 (≠ G174), R181 (= R175), A211 (≠ V202), V212 (≠ L203), P213 (= P204), T218 (= T209), I239 (≠ V230), A240 (≠ G231), R241 (= R232), H288 (= H279), G290 (≠ A281)
Sites not aligning to the query:
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
40% identity, 77% coverage: 57:305/325 of query aligns to 56:313/332 of 6biiA
- active site: L99 (= L100), R240 (= R232), D264 (= D256), E269 (= E261), H287 (= H279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (= V76), T103 (≠ V104), G156 (= G151), F157 (≠ L152), G158 (= G153), R159 (= R154), I160 (= I155), A179 (≠ G174), R180 (= R175), S181 (vs. gap), K183 (vs. gap), V211 (≠ L203), P212 (= P204), E216 (≠ A208), T217 (= T209), V238 (= V230), A239 (≠ G231), R240 (= R232), D264 (= D256), H287 (= H279), G289 (≠ A281)
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
39% identity, 76% coverage: 67:313/325 of query aligns to 70:319/324 of 2gcgA
- active site: L103 (= L100), R241 (= R232), D265 (= D256), E270 (= E261), H289 (= H279)
- binding (2r)-2,3-dihydroxypropanoic acid: S78 (≠ G75), V79 (= V76), G80 (= G77), R241 (= R232), H289 (= H279)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (= V76), T107 (≠ V104), G156 (= G151), G158 (= G153), I160 (= I155), G180 (= G174), R181 (= R175), R184 (vs. gap), C212 (≠ L203), S213 (≠ P204), T218 (= T209), I239 (≠ V230), R241 (= R232), D265 (= D256), H289 (= H279), G291 (≠ A281)
Sites not aligning to the query:
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
40% identity, 74% coverage: 67:305/325 of query aligns to 74:319/328 of Q9UBQ7
- VG 83:84 (= VG 76:77) binding substrate
- GRI 162:164 (= GRI 153:155) binding NADP(+)
- RQPR 185:188 (≠ RH-- 175:176) binding NADP(+)
- S217 (≠ P204) binding NADP(+)
- I243 (≠ V230) binding NADP(+)
- R245 (= R232) binding substrate
- D269 (= D256) binding substrate
- HIGS 293:296 (≠ HVAS 279:282) binding substrate
- G295 (≠ A281) binding NADP(+)
2dbqA Crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with NADP (i41) (see paper)
39% identity, 78% coverage: 57:311/325 of query aligns to 57:318/333 of 2dbqA
- active site: L100 (= L100), R241 (= R232), D265 (= D256), E270 (= E261), H288 (= H279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V76), T104 (≠ V104), L158 (= L152), G159 (= G153), R160 (= R154), I161 (= I155), S180 (≠ G174), R181 (= R175), T182 (≠ H176), A211 (≠ V202), V212 (≠ L203), P213 (= P204), T218 (= T209), I239 (≠ V230), A240 (≠ G231), R241 (= R232), D265 (= D256), H288 (= H279), G290 (≠ A281)
O58320 Glyoxylate reductase; EC 1.1.1.26 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
39% identity, 78% coverage: 57:311/325 of query aligns to 57:318/334 of O58320
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
33% identity, 77% coverage: 68:317/325 of query aligns to 70:320/533 of O43175
- T78 (≠ V76) binding NAD(+)
- R135 (≠ A133) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (= RI 154:155) binding NAD(+)
- D175 (= D179) binding NAD(+)
- T207 (≠ I200) binding NAD(+)
- CAR 234:236 (≠ VGR 230:232) binding NAD(+)
- D260 (= D256) binding NAD(+)
- V261 (= V257) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HVAS 279:282) binding NAD(+)
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
33% identity, 73% coverage: 68:305/325 of query aligns to 66:305/305 of 6plfA
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
33% identity, 72% coverage: 68:300/325 of query aligns to 65:299/303 of 6plgA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
33% identity, 72% coverage: 68:300/325 of query aligns to 65:299/301 of 6rj5A
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
33% identity, 70% coverage: 68:293/325 of query aligns to 64:291/297 of 6rj3A
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
33% identity, 72% coverage: 68:300/325 of query aligns to 64:298/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (≠ L100), A100 (≠ V104), R149 (= R154), I150 (= I155), Y168 (= Y173), D169 (= D179), P170 (≠ G180), I171 (≠ V181), H200 (≠ L199), T201 (≠ I200), P202 (≠ S201), T207 (= T209), C228 (≠ V230), A229 (≠ G231), R230 (= R232), H277 (= H279), G279 (≠ A281)
7dkmA Phgdh covalently linked to oridonin (see paper)
33% identity, 72% coverage: 68:300/325 of query aligns to 66:300/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ V76), A102 (≠ V104), G148 (= G151), R151 (= R154), I152 (= I155), Y170 (= Y173), D171 (= D179), P172 (≠ G180), I173 (≠ V181), H202 (≠ L199), T203 (≠ I200), P204 (≠ S201), T209 (= T209), C230 (≠ V230), A231 (≠ G231), R232 (= R232), H279 (= H279), G281 (≠ A281)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: E293 (≠ Q293)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
33% identity, 72% coverage: 68:300/325 of query aligns to 65:299/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (= L150), G147 (= G151), L148 (= L152), G149 (= G153), R150 (= R154), I151 (= I155), G152 (= G156), D170 (= D179), H201 (≠ L199), T202 (≠ I200), P203 (≠ S201)
Query Sequence
>WP_037454055.1 NCBI__GCF_000576635.1:WP_037454055.1
MSKPEILQIAPMLPIVTDQLDKMFTLHRLWEASDKDAWLTEHGARIRGVAAGGHAGVDES
LMARLPTLEIIGAFGVGYDQIDAKWAGEHGIVVTNTPDVLTDEVADLTIGLLLSTVRQIP
GAERHLREGKWPAGNYPLTASLRGRKVGILGLGRIGKAIAKRLQAFGLPISYYGRHKQDG
VEFPYVADPVELARQVDILISVLPGGAATEKLIGSAVFEALGSDGVFVNVGRGSVVDEAA
LIEALRSKTILGAGIDVFADEPNVPAELIARENAVLLPHVASATVHTRNAMGQLVVDNLV
SWFDGRGALTPVPETKAAAEKAGKK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory