SitesBLAST
Comparing WP_037571892.1 NCBI__GCF_000744815.1:WP_037571892.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4jqoA Crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with citrulline and inorganic phosphate
65% identity, 100% coverage: 1:336/337 of query aligns to 5:337/338 of 4jqoA
- active site: R63 (= R59), T64 (= T60), D91 (≠ A87), R112 (= R108), H139 (= H135), Q142 (= Q138), D237 (= D236), C279 (= C278), R324 (= R323)
- binding citrulline: H139 (= H135), Q142 (= Q138), N173 (= N172), D237 (= D236), S241 (= S240), M242 (= M241), C279 (= C278), L280 (= L279), R324 (= R323)
4h31A Crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with carbamoyl phosphate and l-norvaline
65% identity, 100% coverage: 1:336/337 of query aligns to 3:335/335 of 4h31A
- active site: R61 (= R59), T62 (= T60), D89 (≠ A87), R110 (= R108), H137 (= H135), Q140 (= Q138), D235 (= D236), C277 (= C278), R322 (= R323)
- binding phosphoric acid mono(formamide)ester: S59 (= S57), T60 (= T58), R61 (= R59), T62 (= T60), R110 (= R108), H137 (= H135), Q140 (= Q138), C277 (= C278), L278 (= L279), R322 (= R323)
- binding norvaline: L132 (= L130), N171 (= N172), D235 (= D236), S239 (= S240), M240 (= M241)
4jhxA Crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with carbamoylphosphate and arginine
65% identity, 100% coverage: 1:336/337 of query aligns to 3:335/336 of 4jhxA
- active site: R61 (= R59), T62 (= T60), D89 (≠ A87), R110 (= R108), H137 (= H135), Q140 (= Q138), D235 (= D236), C277 (= C278), R322 (= R323)
- binding arginine: L132 (= L130), N171 (= N172), D235 (= D236), S239 (= S240), M240 (= M241), P279 (= P280)
- binding phosphoric acid mono(formamide)ester: S59 (= S57), T60 (= T58), R61 (= R59), T62 (= T60), R110 (= R108), H137 (= H135), C277 (= C278), L278 (= L279), R322 (= R323)
4jfrB Crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with carbamoyl phosphate
65% identity, 100% coverage: 1:336/337 of query aligns to 7:339/340 of 4jfrB
- active site: R65 (= R59), T66 (= T60), D93 (≠ A87), R114 (= R108), H141 (= H135), Q144 (= Q138), D239 (= D236), C281 (= C278), R326 (= R323)
- binding phosphoric acid mono(formamide)ester: S63 (= S57), T64 (= T58), R65 (= R59), T66 (= T60), R114 (= R108), H141 (= H135), Q144 (= Q138), C281 (= C278), R326 (= R323)
Q8DCF5 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Vibrio vulnificus (strain CMCP6)
65% identity, 100% coverage: 1:336/337 of query aligns to 1:333/334 of Q8DCF5
- STRT 57:60 (= STRT 57:60) binding carbamoyl phosphate
- Q84 (≠ H84) binding carbamoyl phosphate
- R108 (= R108) binding carbamoyl phosphate
- HPTQ 135:138 (= HPTQ 135:138) binding carbamoyl phosphate
- N169 (= N172) binding L-ornithine
- D233 (= D236) binding L-ornithine
- SM 237:238 (= SM 240:241) binding L-ornithine
- CL 275:276 (= CL 278:279) binding carbamoyl phosphate
- R320 (= R323) binding carbamoyl phosphate
1duvG Crystal structure of e. Coli ornithine transcarbamoylase complexed with ndelta-l-ornithine-diaminophosphinyl-n-sulphonic acid (psorn) (see paper)
64% identity, 98% coverage: 7:335/337 of query aligns to 5:331/333 of 1duvG
- binding ndelta-(n'-sulphodiaminophosphinyl)-l-ornithine: S55 (= S57), T56 (= T58), R57 (= R59), T58 (= T60), R106 (= R108), L128 (= L130), H133 (= H135), N167 (= N172), D231 (= D236), S235 (= S240), M236 (= M241), C273 (= C278), L274 (= L279), R319 (= R323)
P04391 Ornithine carbamoyltransferase subunit I; OTCase-1; EC 2.1.3.3 from Escherichia coli (strain K12) (see 7 papers)
64% identity, 98% coverage: 7:335/337 of query aligns to 6:332/334 of P04391
- S56 (= S57) mutation to H: Much less active than the wild-type.
- STRT 56:59 (= STRT 57:60) binding carbamoyl phosphate
- R58 (= R59) mutation to G: The mutant is drastically inefficient in catalysis, but affects only moderately the binding of carbamoyl phosphate.
- Q83 (≠ H84) binding carbamoyl phosphate
- K87 (= K88) mutation to Q: Much less active than the wild-type.
- R107 (= R108) binding carbamoyl phosphate
- HPTQ 134:137 (= HPTQ 135:138) binding carbamoyl phosphate
- N168 (= N172) binding L-ornithine
- D232 (= D236) binding L-ornithine
- SM 236:237 (= SM 240:241) binding L-ornithine
- C274 (= C278) binding Zn(2+); mutation to A: Zinc ion is no longer a tight-binding inhibitor and does not promote isomerization.
- CL 274:275 (= CL 278:279) binding carbamoyl phosphate
- R320 (= R323) binding carbamoyl phosphate; mutation to A: Much less active than the wild-type.
- A326 (= A329) mutation to G: Activity greater than the wild-type and Km for ornithwinas increases about twofold.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2otcA Ornithine transcarbamoylase complexed with n-(phosphonacetyl)-l- ornithine (see paper)
64% identity, 98% coverage: 7:335/337 of query aligns to 5:331/333 of 2otcA
- active site: R57 (= R59), T58 (= T60), H85 (≠ A87), R106 (= R108), H133 (= H135), Q136 (= Q138), D231 (= D236), C273 (= C278), R319 (= R323)
- binding n-(phosphonoacetyl)-l-ornithine: S55 (= S57), T56 (= T58), R57 (= R59), T58 (= T60), R106 (= R108), H133 (= H135), N167 (= N172), D231 (= D236), S235 (= S240), M236 (= M241), L274 (= L279), R319 (= R323)
P08308 Ornithine carbamoyltransferase, catabolic; OTCase; EC 2.1.3.3 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 4 papers)
59% identity, 100% coverage: 1:337/337 of query aligns to 1:335/336 of P08308
- M1 (= M1) modified: Initiator methionine, Removed
- E106 (≠ Q106) mutation E->A,G: Loss of homotropic cooperativity; gain of anabolic activity. Conformational change which modifies the catalytic site. This mutant is blocked in the active R (relaxed) state.
Q8G998 Ornithine carbamoyltransferase, catabolic; OTCase; EC 2.1.3.3 from Lentilactobacillus hilgardii (Lactobacillus hilgardii) (see paper)
53% identity, 98% coverage: 8:337/337 of query aligns to 13:337/343 of Q8G998
- H79 (= H74) binding Ni(2+)
Sites not aligning to the query:
- 337:343 mutation Missing: It generates a metastable mutant that behaves as a mixture of monomeric and trimeric species with only the latter exhibiting OTC activity.
Q51742 Ornithine carbamoyltransferase, anabolic; OTCase; EC 2.1.3.3 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 3 papers)
40% identity, 100% coverage: 1:336/337 of query aligns to 1:311/315 of Q51742
- M1 (= M1) modified: Initiator methionine, Removed
- W22 (≠ R22) mutation to A: Decreased heat stability.
- E26 (≠ D26) mutation to Q: Increased dissociation of dodecamers into trimers.
- M30 (≠ Q30) mutation to A: Increased dissociation of dodecamers into trimers.
- W34 (≠ A34) mutation to A: Increased dissociation of dodecamers into trimers.
- Y228 (= Y234) mutation to C: Becomes active at low temperatures; when associated with G-278.
- A241 (≠ V247) mutation to D: Becomes active at low temperatures; when associated with G-278.
- E278 (= E303) mutation to G: Becomes active at low temperatures; when associated with C-228 or D-241.
7nouA Crystal structure of mycobacterium tuberculosis argf in complex with (3,5-dichlorophenyl)boronic acid.
40% identity, 96% coverage: 8:332/337 of query aligns to 4:302/308 of 7nouA
- active site: R102 (= R108), H129 (= H135), Q132 (= Q138), D225 (= D236), C265 (= C278), R293 (= R323)
- binding [3,5-bis(chloranyl)phenyl]-oxidanyl-oxidanylidene-boron: I46 (≠ V52), T52 (= T58), R53 (= R59), R53 (= R59), F56 (≠ C62), F56 (≠ C62), L79 (= L85), D82 (≠ K88), E83 (= E89), V91 (= V97), Y95 (≠ M101), L266 (= L279), R293 (= R323)
7nosA Crystal structure of mycobacterium tuberculosis argf in complex with 4-bromo-6-(trifluoromethyl)-1h-benzo[d]imidazole.
40% identity, 96% coverage: 8:332/337 of query aligns to 4:302/308 of 7nosA
7norA Crystal structure of mycobacterium tuberculosis argf in complex with 2-fluoro-4-hydroxybenzonitrile.
40% identity, 96% coverage: 8:332/337 of query aligns to 4:302/308 of 7norA
7nnyA Crystal structure of mycobacterium tuberculosis argf in complex with naphthalen-1-ol.
40% identity, 96% coverage: 8:332/337 of query aligns to 4:302/308 of 7nnyA
- active site: R102 (= R108), H129 (= H135), Q132 (= Q138), D225 (= D236), C265 (= C278), R293 (= R323)
- binding 1-naphthol: T52 (= T58), R53 (= R59), F56 (≠ C62), E83 (= E89), V91 (= V97), Y95 (≠ M101)
7nnwA Crystal structure of mycobacterium tuberculosis argf in complex with methyl 4-hydroxy-3-iodobenzoate.
40% identity, 96% coverage: 8:332/337 of query aligns to 4:302/308 of 7nnwA
- active site: R102 (= R108), H129 (= H135), Q132 (= Q138), D225 (= D236), C265 (= C278), R293 (= R323)
- binding methyl 3-iodanyl-4-oxidanyl-benzoate: I46 (≠ V52), T52 (= T58), R53 (= R59), F56 (≠ C62), L79 (= L85), L92 (= L98), Y95 (≠ M101)
7nnvA Crystal structure of mycobacterium tuberculosis argf in complex with carbamoyl phosphate.
40% identity, 96% coverage: 8:332/337 of query aligns to 4:302/308 of 7nnvA
- active site: R102 (= R108), H129 (= H135), Q132 (= Q138), D225 (= D236), C265 (= C278), R293 (= R323)
- binding phosphoric acid mono(formamide)ester: S51 (= S57), T52 (= T58), R53 (= R59), T54 (= T60), R102 (= R108), H129 (= H135), C265 (= C278), L266 (= L279), R293 (= R323)
P9WIT9 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
40% identity, 96% coverage: 8:332/337 of query aligns to 3:301/307 of P9WIT9
- STRT 50:53 (= STRT 57:60) binding carbamoyl phosphate
- Q77 (≠ H84) binding carbamoyl phosphate
- R101 (= R108) binding carbamoyl phosphate
- HPCQ 128:131 (≠ HPTQ 135:138) binding carbamoyl phosphate
- N160 (= N172) binding L-ornithine
- D224 (= D236) binding L-ornithine
- SM 228:229 (= SM 240:241) binding L-ornithine
- CL 264:265 (= CL 278:279) binding carbamoyl phosphate
- R292 (= R323) binding carbamoyl phosphate
2i6uA Crystal structure of ornithine carbamoyltransferase complexed with carbamoyl phosphate and l-norvaline from mycobacterium tuberculosis (rv1656) at 2.2 a (see paper)
40% identity, 96% coverage: 8:332/337 of query aligns to 3:301/307 of 2i6uA
- active site: R52 (= R59), T53 (= T60), R80 (≠ A87), R101 (= R108), H128 (= H135), Q131 (= Q138), D224 (= D236), C264 (= C278), R292 (= R323)
- binding phosphoric acid mono(formamide)ester: S50 (= S57), T51 (= T58), R52 (= R59), T53 (= T60), R101 (= R108), C264 (= C278), L265 (= L279), R292 (= R323)
- binding norvaline: L123 (= L130), N160 (= N172), D224 (= D236), S228 (= S240), M229 (= M241)
Q81M99 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Bacillus anthracis
38% identity, 95% coverage: 15:333/337 of query aligns to 19:307/316 of Q81M99
- STRT 57:60 (= STRT 57:60) binding carbamoyl phosphate
- Q84 (≠ H84) binding carbamoyl phosphate
- R108 (= R108) binding carbamoyl phosphate
- HPCQ 135:138 (≠ HPTQ 135:138) binding carbamoyl phosphate
- N166 (= N172) binding L-ornithine
- D230 (= D236) binding L-ornithine
- SM 234:235 (= SM 240:241) binding L-ornithine
- CL 269:270 (= CL 278:279) binding carbamoyl phosphate
- R297 (= R323) binding carbamoyl phosphate
Query Sequence
>WP_037571892.1 NCBI__GCF_000744815.1:WP_037571892.1
MAFNLRHRHFLKELDFTAQEFRFLLDLAAQLKAAKYAGTEQPRLRGRNIALVFEKGSTRT
RCSFEVAAADQGAHTTYLDPSGSHLGAKESIKDSARVLGRMFDGIQYRGHGQAVVEELAA
YAGVPVWNGLTDEWHPTQMLADLLTIEEHNAATNGKPLARTALAYLGDARNNMGNSLLVT
GALMGMDIRIVAPESLWPTAEVRAEAERLAARSGARITLTADVEQGVAGADYVYTDVWVS
MGEPKEVWAERIELLTPYQINMDVIRATGNPGVRFLHCLPAFHDLGTQVARDLHATTGLT
ELEVTDEVFESEYSLVFDEAENRMHTIKAVLVATLGD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory