SitesBLAST
Comparing WP_037572589.1 NCBI__GCF_000744815.1:WP_037572589.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
32% identity, 83% coverage: 24:282/313 of query aligns to 24:294/324 of 2gcgA
- active site: L103 (≠ H98), R241 (= R230), D265 (= D253), E270 (= E258), H289 (= H277)
- binding (2r)-2,3-dihydroxypropanoic acid: L55 (≠ P51), S78 (≠ T75), V79 (≠ A76), G80 (= G77), R241 (= R230), H289 (= H277)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (≠ A76), T107 (= T102), G156 (= G146), G158 (= G148), I160 (= I150), G180 (≠ A170), R181 (= R171), R184 (= R174), C212 (≠ L201), S213 (≠ P202), T218 (≠ S207), I239 (≠ V228), R241 (= R230), D265 (= D253), H289 (= H277), G291 (= G279)
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
32% identity, 83% coverage: 24:282/313 of query aligns to 28:298/328 of Q9UBQ7
- VG 83:84 (≠ AG 76:77) binding substrate
- GRI 162:164 (≠ GSI 148:150) binding NADP(+)
- RQPR 185:188 (≠ RSAR 171:174) binding NADP(+)
- S217 (≠ P202) binding NADP(+)
- I243 (≠ V228) binding NADP(+)
- R245 (= R230) binding substrate
- D269 (= D253) binding substrate
- HIGS 293:296 (≠ HVGG 277:280) binding substrate
- G295 (= G279) binding NADP(+)
5vg6B Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from xanthobacter autotrophicus py2 in complex with NADPH and mes.
36% identity, 73% coverage: 61:288/313 of query aligns to 59:286/315 of 5vg6B
- active site: M98 (≠ T102), R230 (= R230), D254 (= D253), E259 (= E258), H278 (= H277)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A74 (= A76), R92 (≠ G96), M102 (≠ A106), L147 (≠ Y147), G148 (= G148), D149 (≠ S149), L150 (≠ I150), W168 (≠ I166), S169 (≠ V167), R170 (= R168), T171 (≠ V169), K173 (≠ R171), L201 (= L201), P202 (= P202), T207 (≠ S207), V228 (= V228), R230 (= R230), H278 (= H277), A280 (≠ S282), S281 (= S283)
Sites not aligning to the query:
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
33% identity, 79% coverage: 66:312/313 of query aligns to 66:323/334 of 5aovA
- active site: L100 (≠ H98), R241 (= R230), D265 (= D253), E270 (= E258), H288 (= H277)
- binding glyoxylic acid: Y74 (≠ L74), A75 (≠ T75), V76 (≠ A76), G77 (= G77), R241 (= R230), H288 (= H277)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ A76), T104 (= T102), F158 (≠ Y147), G159 (= G148), R160 (≠ S149), I161 (= I150), S180 (≠ A170), R181 (= R171), A211 (≠ V200), V212 (≠ L201), P213 (= P202), T218 (≠ S207), I239 (≠ V228), A240 (= A229), R241 (= R230), H288 (= H277), G290 (= G279)
Sites not aligning to the query:
5mhaB D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
34% identity, 75% coverage: 71:305/313 of query aligns to 62:302/308 of 5mhaB
- binding 2-Ketohexanoic acid: R66 (≠ T75), R226 (= R230), H274 (= H277), Y282 (≠ F285)
- binding (2R)-2-hydroxyhexanoic acid: R66 (≠ T75), A67 (= A76), G68 (= G77), H91 (= H98), Y282 (≠ F285)
- binding magnesium ion: F212 (≠ L216), E213 (≠ A217), M215 (= M219), D243 (≠ R247)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A67 (= A76), G68 (= G77), T88 (≠ R95), L143 (≠ Y147), G144 (= G148), T145 (≠ S149), L146 (≠ I150), R165 (≠ A170), R166 (= R171), S167 (= S172), P180 (vs. gap), T197 (≠ L201), P198 (= P202), T203 (≠ S207), V224 (= V228), A225 (= A229), R226 (= R230), H274 (= H277), S276 (≠ G279)
5mhaA D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
34% identity, 75% coverage: 71:305/313 of query aligns to 62:302/308 of 5mhaA
- binding 2-Ketohexanoic acid: R66 (≠ T75), A67 (= A76), G68 (= G77), H91 (= H98), R226 (= R230), H274 (= H277), Y282 (≠ F285)
- binding magnesium ion: T132 (≠ S136), A134 (= A138)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A67 (= A76), G68 (= G77), T88 (≠ R95), L143 (≠ Y147), G144 (= G148), T145 (≠ S149), L146 (≠ I150), R165 (≠ A170), R166 (= R171), S167 (= S172), P180 (vs. gap), T197 (≠ L201), P198 (= P202), T203 (≠ S207), V224 (= V228), A225 (= A229), R226 (= R230), H274 (= H277), S276 (≠ G279)
5mh5A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-keto-hexanoic acid and NADP+ (1.4 a resolution)
34% identity, 75% coverage: 71:305/313 of query aligns to 62:302/308 of 5mh5A
- binding 2-Ketohexanoic acid: R66 (≠ T75), A67 (= A76), G68 (= G77), H91 (= H98), R226 (= R230), H274 (= H277), Y282 (≠ F285)
- binding magnesium ion: T132 (≠ S136), A134 (= A138), F212 (≠ L216), E213 (≠ A217), M215 (= M219), D243 (≠ R247)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A67 (= A76), G68 (= G77), T88 (≠ R95), G142 (= G146), L143 (≠ Y147), G144 (= G148), T145 (≠ S149), L146 (≠ I150), R165 (≠ A170), R166 (= R171), S167 (= S172), T197 (≠ L201), P198 (= P202), T203 (≠ S207), V224 (= V228), A225 (= A229), R226 (= R230), H274 (= H277), S276 (≠ G279)
5mh6A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-ketohexanoic acid and NAD+ (1.35 a resolution)
34% identity, 75% coverage: 71:305/313 of query aligns to 60:300/306 of 5mh6A
- binding 2-Ketohexanoic acid: R64 (≠ T75), A65 (= A76), G66 (= G77), H89 (= H98), R224 (= R230), H272 (= H277), Y280 (≠ F285)
- binding magnesium ion: T130 (≠ S136), A132 (= A138), F210 (≠ L216), E211 (≠ A217), M213 (= M219), G225 (= G231), P226 (= P232), V228 (= V234), E230 (≠ T236), D241 (≠ R247), S251 (≠ D256)
- binding nicotinamide-adenine-dinucleotide: A65 (= A76), G66 (= G77), T86 (≠ R95), H89 (= H98), G142 (= G148), T143 (≠ S149), L144 (≠ I150), R164 (= R171), P196 (= P202), T201 (≠ S207), V222 (= V228), A223 (= A229), R224 (= R230), H272 (= H277), S274 (≠ G279)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
31% identity, 79% coverage: 66:312/313 of query aligns to 65:322/332 of 6biiA
- active site: L99 (≠ A106), R240 (= R230), D264 (= D253), E269 (= E258), H287 (= H277)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (≠ A76), T103 (≠ A110), G156 (= G146), F157 (≠ Y147), G158 (= G148), R159 (≠ S149), I160 (= I150), A179 (= A170), R180 (= R171), S181 (= S172), K183 (≠ R174), V211 (≠ L201), P212 (= P202), E216 (≠ Q206), T217 (≠ S207), V238 (= V228), A239 (= A229), R240 (= R230), D264 (= D253), H287 (= H277), G289 (= G279)
7arzA Ternary complex of NAD-dependent formate dehydrogenase from physcomitrium patens
33% identity, 71% coverage: 62:282/313 of query aligns to 90:320/361 of 7arzA
- binding azide ion: L99 (≠ V71), V100 (≠ Q72), T101 (= T73), G103 (≠ T75), V104 (≠ A76), R267 (= R230), H315 (= H277)
- binding nicotinamide-adenine-dinucleotide: V104 (≠ A76), N128 (≠ H98), V132 (≠ T102), G182 (= G148), R183 (≠ S149), I184 (= I150), D204 (≠ A170), R205 (= R171), T238 (≠ L201), P239 (= P202), Q243 (= Q206), N265 (≠ V228), A266 (= A229), R267 (= R230), D291 (= D253), H315 (= H277), S317 (≠ G279), G318 (= G280)
Sites not aligning to the query:
4zqbB Crystal structure of NADP-dependent dehydrogenase from rhodobactersphaeroides in complex with NADP and sulfate
35% identity, 71% coverage: 62:283/313 of query aligns to 61:285/316 of 4zqbB
- active site: L99 (= L105), R231 (= R230), E260 (= E258), H279 (= H277)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R93 (≠ D99), M103 (≠ L109), G147 (= G146), L148 (≠ Y147), G149 (= G148), E150 (≠ S149), L151 (≠ I150), W169 (≠ V169), S170 (≠ A170), R171 (= R171), S172 (= S172), K174 (≠ R174), L202 (= L201), P203 (= P202), F229 (≠ V228), R231 (= R230), H279 (= H277), S281 (≠ G279), A282 (≠ G280)
Sites not aligning to the query:
O58320 Glyoxylate reductase; EC 1.1.1.26 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
30% identity, 94% coverage: 18:312/313 of query aligns to 16:323/334 of O58320
- LGRI 158:161 (vs. gap) binding NADP(+)
- SRT 180:182 (≠ ARS 170:172) binding NADP(+)
- IAR 239:241 (≠ VAR 228:230) binding NADP(+)
- HIG 288:290 (≠ HVG 277:279) binding NADP(+)
2dbqA Crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with NADP (i41) (see paper)
30% identity, 94% coverage: 18:312/313 of query aligns to 16:323/333 of 2dbqA
- active site: L100 (≠ H98), R241 (= R230), D265 (= D253), E270 (= E258), H288 (= H277)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ A76), T104 (= T102), L158 (vs. gap), G159 (vs. gap), R160 (vs. gap), I161 (vs. gap), S180 (≠ A170), R181 (= R171), T182 (≠ S172), A211 (≠ V200), V212 (≠ L201), P213 (= P202), T218 (≠ S207), I239 (≠ V228), A240 (= A229), R241 (= R230), D265 (= D253), H288 (= H277), G290 (= G279)
7jqhA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with phosphate and NADP+
32% identity, 78% coverage: 68:312/313 of query aligns to 58:309/313 of 7jqhA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A66 (= A76), R90 (≠ G96), M100 (vs. gap), A145 (≠ Y147), G146 (= G148), V147 (≠ S149), L148 (≠ I150), W166 (≠ A164), S167 (≠ E165), R168 (≠ I166), T169 (≠ V167), K171 (≠ V169), L199 (= L201), P200 (= P202), L226 (≠ V228), A227 (= A229), R228 (= R230), D252 (= D253), H276 (= H277), A279 (≠ G280)
Sites not aligning to the query:
7jqiA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with alpha-ketoglutarate and NADP+
32% identity, 78% coverage: 68:312/313 of query aligns to 57:308/312 of 7jqiA
- binding 2-oxoglutaric acid: G64 (≠ T75), A65 (= A76), G66 (= G77), R227 (= R230), H275 (= H277)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A76), R89 (≠ G96), M99 (vs. gap), A144 (≠ Y147), G145 (= G148), V146 (≠ S149), L147 (≠ I150), W165 (≠ A164), S166 (≠ E165), R167 (≠ I166), T168 (≠ V167), K170 (≠ V169), L198 (= L201), P199 (= P202), L225 (≠ V228), R227 (= R230), H275 (= H277), A278 (≠ G280)
Sites not aligning to the query:
6p35A 2.5 angstrom structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with 2-keto arginine and NADP
32% identity, 78% coverage: 68:312/313 of query aligns to 57:308/312 of 6p35A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A76), R89 (≠ G96), M99 (vs. gap), A144 (≠ Y147), G145 (= G148), V146 (≠ S149), L147 (≠ I150), W165 (≠ A164), S166 (≠ E165), R167 (≠ I166), T168 (≠ V167), K170 (≠ V169), L198 (= L201), P199 (= P202), L225 (≠ V228), R227 (= R230), H275 (= H277), A277 (≠ G279), A278 (≠ G280)
- binding 5-[(diaminomethylidene)amino]-2-oxopentanoic acid: A65 (= A76), R227 (= R230), H275 (= H277), T280 (≠ S282)
Sites not aligning to the query:
3kboA 2.14 angstrom crystal structure of putative oxidoreductase (ycdw) from salmonella typhimurium in complex with NADP
32% identity, 78% coverage: 68:312/313 of query aligns to 57:308/312 of 3kboA
- active site: M95 (≠ T102), R227 (= R230), E256 (= E258), H275 (= H277)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (≠ G96), M99 (vs. gap), G143 (= G146), A144 (≠ Y147), G145 (= G148), V146 (≠ S149), L147 (≠ I150), W165 (≠ A164), S166 (≠ E165), R167 (≠ I166), S168 (≠ V167), K170 (≠ V169), L197 (≠ V200), P199 (= P202), L225 (≠ V228), A226 (= A229), R227 (= R230), D251 (= D253), H275 (= H277), A278 (≠ G280)
Sites not aligning to the query:
4e5pA Thermostable phosphite dehydrogenase a176r variant in complex with nad (see paper)
33% identity, 81% coverage: 61:312/313 of query aligns to 61:327/332 of 4e5pA
- active site: L100 (≠ H98), R237 (= R230), D261 (= D253), E266 (= E258), H292 (= H277)
- binding nicotinamide-adenine-dinucleotide: K76 (≠ A76), L100 (≠ H98), T104 (= T102), G154 (= G148), A155 (≠ S149), I156 (= I150), A175 (= A170), R176 (= R171), L208 (= L201), P209 (= P202), T214 (≠ S207), P235 (≠ V228), C236 (≠ A229), R237 (= R230), H292 (= H277)
4e5mA Thermostable phosphite dehydrogenase e175a/a176r in complex with NADP (see paper)
33% identity, 81% coverage: 61:312/313 of query aligns to 61:327/329 of 4e5mA
- active site: L100 (≠ H98), R237 (= R230), D261 (= D253), E266 (= E258), H292 (= H277)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K76 (≠ A76), L100 (≠ H98), T104 (= T102), G154 (= G148), A155 (≠ S149), I156 (= I150), R176 (= R171), L208 (= L201), P209 (= P202), T214 (≠ S207), P235 (≠ V228), C236 (≠ A229), R237 (= R230), H292 (= H277), G294 (= G279)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
31% identity, 70% coverage: 61:279/313 of query aligns to 61:281/313 of Q65CJ7
Query Sequence
>WP_037572589.1 NCBI__GCF_000744815.1:WP_037572589.1
MTTDQPARYLLPYPPEEIGGLPPELPVAVWDGSTPPPAPEALAHVEFFCLPYLRTAKAVP
LLTRLPALRLVQTLTAGVDDLLPHLPPGVAACNARGLHDASTAELAVTLALASLRGVPQF
VRNQAQGLWKQEFHPSLADRRVLIVGYGSIGTAIEDRLRPFECAEIVRVARSAREAPAGR
VHAISELPGLLPDADLVILVLPLTDQSRGLVDAEFLAAMKDGALLVNVARGPIVDTKALL
AELESGRLRAALDVTDPEPLPAGHPLWQAPGVLITPHVGGPSSAFLPRALRLLRRQVLCY
QAGEEPPGLVARG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory