Comparing WP_037573514.1 NCBI__GCF_000744815.1:WP_037573514.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
8cqxA Ribokinase from t.Sp mutant a92g
34% identity, 98% coverage: 1:364/372 of query aligns to 1:295/300 of 8cqxA
6znxC Ribokinase from thermus species
32% identity, 89% coverage: 34:364/372 of query aligns to 21:260/265 of 6znxC
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
27% identity, 99% coverage: 2:371/372 of query aligns to 4:306/306 of 4xckA
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
28% identity, 68% coverage: 2:254/372 of query aligns to 4:225/305 of 1rk2A
Sites not aligning to the query:
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 68% coverage: 2:254/372 of query aligns to 7:228/309 of P0A9J6
Sites not aligning to the query:
1gqtB Activation of ribokinase by monovalent cations (see paper)
28% identity, 68% coverage: 2:254/372 of query aligns to 6:227/307 of 1gqtB
Sites not aligning to the query:
>WP_037573514.1 NCBI__GCF_000744815.1:WP_037573514.1
MIAVVGGVAVETALAVPRLPGVGETVVGGPAARRPGGQGLRQALAAARLAVGSTGGLGGV
RVAILGRVGADPDGELARSALAEEDVDVAWLMGSVDVMTGQRITLHPDGESAGGQAAAVS
PGANAELSAEDCAAAGALLRDAEVTLLQHGGAGDRFGAGARGALADPGAPGVPDEAAAAA
ARLAGGTVLLIPGPVGEVPADLLAMVDVLVPDRDGLAAVVGAAPEDLPDLHAVADAARSL
RGPASVVVRLGPEGALVVEDGAVLLIPPPAAMPSATLAGTPTATPGTAAGAEAGAGAGAG
AGAVDAGGRWGALAGDAFCAGLAVAVAEREPLHEAARFACAAGALVAHGGVRGLSALPTR
EEVERITSRGSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory