Comparing WP_037581589.1 NCBI__GCF_000744815.1:WP_037581589.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WML9 Imidazoleglycerol-phosphate dehydratase; IGPD; EC 4.2.1.19 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
61% identity, 93% coverage: 14:198/198 of query aligns to 21:210/210 of P9WML9
P34047 Imidazoleglycerol-phosphate dehydratase 1, chloroplastic; IGPD 1; Protein HISTIDINE BIOSYNTHESIS 5A; EC 4.2.1.19 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
56% identity, 99% coverage: 2:198/198 of query aligns to 72:267/270 of P34047
O23346 Imidazoleglycerol-phosphate dehydratase 2, chloroplastic; IGPD 2; Protein HISTIDINE BIOSYNTHESIS 5B; EC 4.2.1.19 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
56% identity, 98% coverage: 4:198/198 of query aligns to 76:269/272 of O23346
Sites not aligning to the query:
5el9A A. Thaliana igpd2 in complex with the triazole-phosphonate inhibitor, (s)-c348, to 1.1a resolution (see paper)
56% identity, 98% coverage: 4:198/198 of query aligns to 3:196/199 of 5el9A
5ekwA A. Thaliana igpd2 in complex with the racemate of the triazole- phosphonate inhibitor, c348 (see paper)
56% identity, 97% coverage: 4:196/198 of query aligns to 3:194/194 of 5ekwA
7fcyA Crystal structure of m.Tuberculosis imidazole glycerol phosphate dehydratase in complex with an inhibitor
60% identity, 87% coverage: 14:186/198 of query aligns to 12:190/190 of 7fcyA
7dnqA Crystal structure of m.Tuberculosis imidazole glycerol phosphate dehydratase in complex with an inhibitor
60% identity, 87% coverage: 14:186/198 of query aligns to 12:190/190 of 7dnqA
7ddvA Crystal structure of m.Tuberculosis imidazole glycerol phosphate dehydratase in complex with an inhibitor
60% identity, 87% coverage: 14:186/198 of query aligns to 12:190/190 of 7ddvA
4lpfA Crystal structure of mycobacterium tuberculosis imidazole glycerol phosphate dehydratase in complex with an inhibitor
60% identity, 87% coverage: 14:186/198 of query aligns to 12:190/190 of 4lpfA
5xdsA Crystal structure of mycobacterium tuberculosis hisb bound with an inhibitor (see paper)
60% identity, 87% coverage: 14:186/198 of query aligns to 12:190/191 of 5xdsA
4lomA Crystal structure of mycobacterium tuberculosis hisb in complex with its substrate
60% identity, 87% coverage: 14:186/198 of query aligns to 12:190/191 of 4lomA
4gquA Crystal structure of hisb from mycobacterium tuberculosis
60% identity, 87% coverage: 14:186/198 of query aligns to 12:190/191 of 4gquA
2f1dA X-ray structure of imidazoleglycerol-phosphate dehydratase (see paper)
56% identity, 92% coverage: 4:186/198 of query aligns to 2:183/183 of 2f1dA
4qnkA The structure of wt a. Thaliana igpd2 in complex with mn2+ and phosphate (see paper)
56% identity, 92% coverage: 4:186/198 of query aligns to 3:184/185 of 4qnkA
4mu1A The structure of wt a. Thaliana igpd2 in complex with mn2+, imidazole, and sulfate at 1.5 a resolution (see paper)
56% identity, 92% coverage: 4:186/198 of query aligns to 3:184/185 of 4mu1A
4mu0A The structure of wt a. Thaliana igpd2 in complex with mn2+ and 1,2,4- triazole at 1.3 a resolution (see paper)
56% identity, 92% coverage: 4:186/198 of query aligns to 3:184/185 of 4mu0A
4mu3A The form a structure of an e21q catalytic mutant of a. Thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution (see paper)
55% identity, 92% coverage: 4:186/198 of query aligns to 3:184/186 of 4mu3A
8qawA Medicago truncatula hisn5 (igpd) in complex with mn, imd, edo, fmt, gol and trs (see paper)
54% identity, 92% coverage: 4:186/198 of query aligns to 3:184/185 of 8qawA
8qavA Medicago truncatula hisn5 (igpd) in complex with mn and ig2 (see paper)
54% identity, 92% coverage: 4:186/198 of query aligns to 2:183/184 of 8qavA
6fwhA Acanthamoeba igpd in complex with r-c348 to 1.7a resolution (see paper)
50% identity, 99% coverage: 3:198/198 of query aligns to 2:195/196 of 6fwhA
>WP_037581589.1 NCBI__GCF_000744815.1:WP_037581589.1
MLNRVGKVERTTKETSVSVEIDLDGTGQVNVHTGVGFYDHMLDQLGRHGLFDLTVKTDGD
LHIDTHHTIEDTALALGAAFRQALGDKKGIYRFGDCTVPLDESLAQVTVDLSGRPYLVHT
EPENMAPMIGTYDTTMTRHILESFVAQAQIALHVHVPYGRNAHHIVECQFKALARALRYA
SERDPRAEGLIPSTKGAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory