Comparing WP_037582103.1 NCBI__GCF_000744815.1:WP_037582103.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
1wa3D Mechanism of the class i kdpg aldolase (see paper)
34% identity, 100% coverage: 2:204/204 of query aligns to 4:199/203 of 1wa3D
3vcrA Crystal structure of a putative kdpg (2-keto-3-deoxy-6- phosphogluconate) aldolase from oleispira antarctica (see paper)
35% identity, 87% coverage: 24:200/204 of query aligns to 29:210/216 of 3vcrA
6oviA Crystal structure of kdpg aldolase from legionella pneumophila with pyruvate captured at low ph as a covalent carbinolamine intermediate
34% identity, 95% coverage: 3:195/204 of query aligns to 8:199/210 of 6oviA
1euaA Schiff base intermediate in kdpg aldolase from escherichia coli (see paper)
33% identity, 89% coverage: 18:199/204 of query aligns to 26:206/213 of 1euaA
P0A955 KHG/KDPG aldolase; EC 4.1.3.16; EC 4.1.2.14 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 89% coverage: 18:199/204 of query aligns to 26:206/213 of P0A955
1wauA Structure of kdpg aldolase e45n mutant (see paper)
33% identity, 89% coverage: 18:199/204 of query aligns to 26:206/213 of 1wauA
2c0aB Mechanism of the class i kdpg aldolase (see paper)
33% identity, 89% coverage: 18:199/204 of query aligns to 27:207/214 of 2c0aB
Sites not aligning to the query:
1mxsA Crystal structure of 2-keto-3-deoxy-6-phosphogluconate (kdpg) aldolase from pseudomonas putida. (see paper)
35% identity, 97% coverage: 8:204/204 of query aligns to 18:213/216 of 1mxsA
P00885 2-dehydro-3-deoxy-phosphogluconate aldolase; KDPG-aldolase; Phospho-2-dehydro-3-deoxygluconate aldolase; Phospho-2-keto-3-deoxygluconate aldolase; EC 4.1.2.14 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
34% identity, 97% coverage: 8:204/204 of query aligns to 28:223/226 of P00885
Sites not aligning to the query:
Q6BF16 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; 2-oxo-3-deoxygalactonate 6-phosphate aldolase; 6-phospho-2-dehydro-3-deoxygalactonate aldolase; 6-phospho-2-keto-3-deoxygalactonate aldolase; KDPGal; EC 4.1.2.21 from Escherichia coli (strain K12) (see paper)
32% identity, 83% coverage: 9:178/204 of query aligns to 9:178/205 of Q6BF16
2v82A Kdpgal complexed to kdpgal (see paper)
32% identity, 83% coverage: 9:178/204 of query aligns to 8:177/205 of 2v82A
Sites not aligning to the query:
5xsfA Crystal structure of the 2-keto-3-deoxy-6-phosphogluconate aldolase of zymomonas mobilis zm4 with 3-phosphoglycerate
31% identity, 95% coverage: 9:202/204 of query aligns to 14:202/209 of 5xsfA
>WP_037582103.1 NCBI__GCF_000744815.1:WP_037582103.1
MDVLAADRVLTVVRAPRIPDAAALCRALAEGGIRTVELTFTTPDLTGHLRAAAAVAAETG
CRIGAGTVLTAGDAAAAVDAGAEFLVTPGLRPEVAAVGRERGVPVVMGAFTPTEVLTALD
LGAAAVKIFPAHALGPRYFKDLRGPLPDVRLLPSGGVNAGNAGEFLAQGAIAVSAGTDAV
PPQAVASGDWPEITRRAREFTAAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory