Comparing WP_038016963.1 NCBI__GCF_000757425.2:WP_038016963.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
O31645 PTS system mannose-specific EIIBCA component; EIIBCA-Man; EII-Man; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see 2 papers)
31% identity, 75% coverage: 32:154/164 of query aligns to 526:648/650 of O31645
Sites not aligning to the query:
>WP_038016963.1 NCBI__GCF_000757425.2:WP_038016963.1
MNSDLTLELGHVLTLECTRNNVHCQSKKRALEIISELAATQLNLPHQTIFETILNRERMG
STGIGNGIAIPHGKLEEDTLRTIGVLIHLEHPIPFDAVDNQPVDLLFALLVPADQCKTHL
HTLSQVAKRLADKTVCRRLRAAQSDQELYSIIMEEQQSSDEKQQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory