SitesBLAST
Comparing WP_038205562.1 NCBI__GCF_000745855.1:WP_038205562.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3nvsA 1.02 angstrom resolution crystal structure of 3-phosphoshikimate 1- carboxyvinyltransferase from vibrio cholerae in complex with shikimate-3-phosphate (partially photolyzed) and glyphosate
52% identity, 66% coverage: 4:441/667 of query aligns to 1:426/426 of 3nvsA
- active site: K22 (= K25), S23 (= S26), D49 (= D52), N94 (= N94), P119 (= P119), R124 (= R124), H128 (≠ D128), Q135 (= Q135), Y142 (= Y142), E144 (≠ G144), A247 (= A253), A255 (= A261), D314 (= D325), E342 (= E353), H386 (= H399), R387 (= R400), K412 (= K427)
- binding glyphosate: K22 (= K25), G96 (= G96), R124 (= R124), Q172 (= Q176), D314 (= D325), E342 (= E353), R345 (= R356), H386 (= H399), R387 (= R400)
- binding magnesium ion: E123 (= E123), Q145 (≠ N145)
- binding shikimate-3-phosphate: K22 (= K25), S23 (= S26), R27 (= R30), T97 (= T97), S170 (= S174), S171 (= S175), Q172 (= Q176), S198 (= S204), Y201 (= Y207), D314 (= D325), N337 (≠ S348), K341 (= K352)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (= S26), R27 (= R30), Q172 (= Q176), Y201 (= Y207), D314 (= D325), K341 (= K352)
Q9KRB0 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
52% identity, 66% coverage: 4:441/667 of query aligns to 1:426/426 of Q9KRB0
- K22 (= K25) binding 3-phosphoshikimate
- S23 (= S26) binding 3-phosphoshikimate
- R27 (= R30) binding 3-phosphoshikimate
- S170 (= S174) binding 3-phosphoshikimate
- S171 (= S175) binding 3-phosphoshikimate
- S198 (= S204) binding 3-phosphoshikimate
- D314 (= D325) binding 3-phosphoshikimate
- N337 (≠ S348) binding 3-phosphoshikimate
- K341 (= K352) binding 3-phosphoshikimate
7tm5B Crystal structure of shikimate-3-phosphate bound 3-phosphoshikimate 1- carboxyvinyltransferase from klebsiella pneumoniae
54% identity, 65% coverage: 4:436/667 of query aligns to 1:420/427 of 7tm5B
- binding shikimate-3-phosphate: K22 (= K25), S23 (= S26), R27 (= R30), S169 (= S174), S170 (= S175), Q171 (= Q176), S197 (= S204), Y200 (= Y207), D313 (= D325), N336 (≠ S348), K340 (= K352)
7tm6A Crystal structure of shikimate-3-phosphate and glyphosate bound 3- phosphoshikimate 1-carboxyvinyltransferase from klebsiella pneumoniae
55% identity, 65% coverage: 6:436/667 of query aligns to 2:419/426 of 7tm6A
- binding glyphosate: K21 (= K25), G95 (= G96), R123 (= R124), Q170 (= Q176), D312 (= D325), E340 (= E353), R343 (= R356), H384 (= H399), R385 (= R400)
- binding shikimate-3-phosphate: S22 (= S26), R26 (= R30), T96 (= T97), S168 (= S174), S169 (= S175), Q170 (= Q176), S196 (= S204), Y199 (= Y207), D312 (= D325), N335 (≠ S348), K339 (= K352)
2pq9A E. Coli epsps liganded with (r)-difluoromethyl tetrahedral reaction intermediate analog (see paper)
52% identity, 66% coverage: 4:442/667 of query aligns to 1:426/427 of 2pq9A
- active site: K22 (= K25), S23 (= S26), D49 (= D52), N94 (= N94), P119 (= P119), R124 (= R124), D313 (= D325), E341 (= E353), H385 (= H399), R386 (= R400), K411 (= K427)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K22 (= K25), S23 (= S26), R27 (= R30), G96 (= G96), T97 (= T97), R124 (= R124), S169 (= S174), S170 (= S175), Q171 (= Q176), S197 (= S204), Y200 (= Y207), D313 (= D325), N336 (≠ S348), K340 (= K352), R344 (= R356), H385 (= H399), R386 (= R400), K411 (= K427)
2aa9A Epsp synthase liganded with shikimate (see paper)
52% identity, 66% coverage: 4:442/667 of query aligns to 1:426/427 of 2aa9A
- active site: K22 (= K25), S23 (= S26), D49 (= D52), N94 (= N94), P119 (= P119), R124 (= R124), D313 (= D325), E341 (= E353), H385 (= H399), R386 (= R400), K411 (= K427)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: K22 (= K25), S23 (= S26), R27 (= R30), T97 (= T97), Q171 (= Q176), Y200 (= Y207), D313 (= D325), K340 (= K352)
1x8tA Epsps liganded with the (r)-phosphonate analog of the tetrahedral reaction intermediate (see paper)
52% identity, 66% coverage: 4:442/667 of query aligns to 1:426/427 of 1x8tA
- active site: K22 (= K25), S23 (= S26), D49 (= D52), N94 (= N94), P119 (= P119), R124 (= R124), D313 (= D325), E341 (= E353), H385 (= H399), R386 (= R400), K411 (= K427)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K22 (= K25), S23 (= S26), R27 (= R30), T97 (= T97), S169 (= S174), S170 (= S175), Q171 (= Q176), S197 (= S204), Y200 (= Y207), D313 (= D325), N336 (≠ S348), K340 (= K352), R344 (= R356), H385 (= H399), R386 (= R400)
1x8rA Epsps liganded with the (s)-phosphonate analog of the tetrahedral reaction intermediate (see paper)
52% identity, 66% coverage: 4:442/667 of query aligns to 1:426/427 of 1x8rA
- active site: K22 (= K25), S23 (= S26), D49 (= D52), N94 (= N94), P119 (= P119), R124 (= R124), D313 (= D325), E341 (= E353), H385 (= H399), R386 (= R400), K411 (= K427)
- binding [3r-[3a,4a,5b(s*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K22 (= K25), S23 (= S26), R27 (= R30), G96 (= G96), T97 (= T97), R124 (= R124), S169 (= S174), S170 (= S175), Q171 (= Q176), S197 (= S204), Y200 (= Y207), D313 (= D325), N336 (≠ S348), K340 (= K352), E341 (= E353), H385 (= H399), K411 (= K427)
1g6tA Structure of epsp synthase liganded with shikimate-3-phosphate (see paper)
52% identity, 66% coverage: 4:442/667 of query aligns to 1:426/427 of 1g6tA
- active site: K22 (= K25), S23 (= S26), D49 (= D52), N94 (= N94), P119 (= P119), R124 (= R124), D313 (= D325), E341 (= E353), H385 (= H399), R386 (= R400), K411 (= K427)
- binding phosphate ion: K22 (= K25), G96 (= G96), T97 (= T97), R124 (= R124), Q171 (= Q176), E341 (= E353), K411 (= K427)
- binding shikimate-3-phosphate: K22 (= K25), S23 (= S26), R27 (= R30), T97 (= T97), S169 (= S174), S170 (= S175), Q171 (= Q176), S197 (= S204), Y200 (= Y207), D313 (= D325), N336 (≠ S348), K340 (= K352)
1g6sA Structure of epsp synthase liganded with shikimate-3-phosphate and glyphosate (see paper)
52% identity, 66% coverage: 4:442/667 of query aligns to 1:426/427 of 1g6sA
- active site: K22 (= K25), S23 (= S26), D49 (= D52), N94 (= N94), P119 (= P119), R124 (= R124), D313 (= D325), E341 (= E353), H385 (= H399), R386 (= R400), K411 (= K427)
- binding glyphosate: K22 (= K25), G96 (= G96), R124 (= R124), Q171 (= Q176), D313 (= D325), E341 (= E353), R344 (= R356), H385 (= H399), R386 (= R400)
- binding shikimate-3-phosphate: K22 (= K25), S23 (= S26), R27 (= R30), T97 (= T97), S169 (= S174), S170 (= S175), Q171 (= Q176), S197 (= S204), Y200 (= Y207), D313 (= D325), N336 (≠ S348), K340 (= K352)
P0A6D3 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Escherichia coli (strain K12) (see 5 papers)
52% identity, 66% coverage: 4:442/667 of query aligns to 1:426/427 of P0A6D3
- K22 (= K25) binding 3-phosphoshikimate
- S23 (= S26) binding 3-phosphoshikimate
- R27 (= R30) binding 3-phosphoshikimate
- G96 (= G96) mutation to A: Insensitive to glyphosate with unaltered affinity for its first substrate S3P, but displays a 30-fold lower affinity for its second substrate PEP.
- T97 (= T97) mutation to I: This mutant is sensitive to glyphosate and causes a substantial decrease in the affinity for PEP. Is insensitive to glyphosate but maintains high affinity for PEP; when associated with S-101.
- P101 (= P101) mutation to A: Displays a slight decrease of the affinity binding for both S3P and PEP. Decreases the binding affinity of glyphosate, reducing the potency of this inhibitor.; mutation to G: Displays a slight decrease of the affinity binding for both S3P and PEP. Decreases the binding affinity of glyphosate, reducing the potency of this inhibitor.; mutation to L: Displays a 2-fold lower affinity binding for both S3P and PEP. Decreases the binding affinity of glyphosate, reducing the potency of this inhibitor.; mutation to S: Displays a slight decrease of the affinity binding for both S3P and PEP. Decreases the binding affinity of glyphosate, reducing the potency of this inhibitor. Is insensitive to glyphosate but maintains high affinity for PEP; when associated with I-97.
- S169 (= S174) binding 3-phosphoshikimate
- S170 (= S175) binding 3-phosphoshikimate
- Q171 (= Q176) binding 3-phosphoshikimate
- S197 (= S204) binding 3-phosphoshikimate
- D313 (= D325) binding 3-phosphoshikimate; mutation to A: The enolpyruvyl transfer reaction is halted after formation of the tetrahedral adduct of the substrates.
- N336 (≠ S348) binding 3-phosphoshikimate
- K340 (= K352) binding 3-phosphoshikimate
- C408 (= C424) Modified by bromopyruvate
- K411 (= K427) Modified by bromopyruvate
3fjzA E. Coli epsp synthase (t97i) liganded with s3p and glyphosate (see paper)
52% identity, 66% coverage: 4:442/667 of query aligns to 1:426/427 of 3fjzA
- active site: K22 (= K25), S23 (= S26), D49 (= D52), N94 (= N94), P119 (= P119), R124 (= R124), D313 (= D325), E341 (= E353), H385 (= H399), R386 (= R400), K411 (= K427)
- binding N-(phosphonomethyl)glycine: K22 (= K25), G96 (= G96), R124 (= R124), Q171 (= Q176), D313 (= D325), E341 (= E353), R344 (= R356), H385 (= H399), R386 (= R400)
- binding shikimate-3-phosphate: K22 (= K25), S23 (= S26), R27 (= R30), I97 (≠ T97), S169 (= S174), S170 (= S175), Q171 (= Q176), S197 (= S204), Y200 (= Y207), D313 (= D325), N336 (≠ S348), K340 (= K352)
- binding serine: I265 (≠ V275), G266 (= G276), S269 (= S279)
1q36A Epsp synthase (asp313ala) liganded with tetrahedral reaction intermediate (see paper)
52% identity, 66% coverage: 4:442/667 of query aligns to 1:426/427 of 1q36A
- active site: K22 (= K25), S23 (= S26), D49 (= D52), N94 (= N94), P119 (= P119), R124 (= R124), A313 (≠ D325), E341 (= E353), H385 (= H399), R386 (= R400), K411 (= K427)
- binding 5-(1-carboxy-1-phosphonooxy-ethoxyl)-4-hydroxy-3-phosphonooxy-cyclohex-1-enecarboxylic acid: K22 (= K25), S23 (= S26), R27 (= R30), G96 (= G96), T97 (= T97), R124 (= R124), S169 (= S174), S170 (= S175), Q171 (= Q176), S197 (= S204), Y200 (= Y207), N336 (≠ S348), K340 (= K352), E341 (= E353), R344 (= R356), R386 (= R400), K411 (= K427)
P11043 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EC 2.5.1.19 from Petunia hybrida (Petunia) (see paper)
48% identity, 64% coverage: 9:436/667 of query aligns to 79:510/516 of P11043
- G173 (= G96) mutation to A: This mutant becomes resistant to glyphosate due to a lower affinity. Shows a slight reduction in EPSP synthase activity.
8umjA Wild type epsp synthase complexed with glyphosate and shikimate-3- phosphate (see paper)
47% identity, 65% coverage: 9:441/667 of query aligns to 7:442/443 of 8umjA
- binding glyphosate: K23 (= K25), G100 (= G96), R130 (= R124), Q179 (= Q176), D330 (= D325), E358 (= E353), R361 (= R356), R403 (= R400)
- binding shikimate-3-phosphate: S24 (= S26), R28 (= R30), S177 (= S174), S178 (= S175), Q179 (= Q176), S205 (= S204), Y208 (= Y207), D330 (= D325), K357 (= K352)
P07547 Pentafunctional AROM polypeptide; EC 4.2.3.4; EC 2.5.1.19; EC 2.7.1.71; EC 4.2.1.10; EC 1.1.1.25 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see 2 papers)
38% identity, 65% coverage: 5:436/667 of query aligns to 393:836/1583 of P07547
Sites not aligning to the query:
- 44:46 binding NAD(+)
- 81:84 binding NAD(+)
- 114:116 binding NAD(+)
- 119 binding NAD(+)
- 139:140 binding NAD(+)
- 161 binding NAD(+)
- 179:182 binding NAD(+)
- 190 binding NAD(+)
- 194 binding Zn(2+)
- 271 binding Zn(2+)
- 287 binding Zn(2+)
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
38% identity, 70% coverage: 5:468/667 of query aligns to 386:868/1555 of 6hqvA
Sites not aligning to the query:
- active site: 123, 145, 187, 243, 253, 257, 261, 264, 268, 280
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: 1060, 1062, 1181, 1224, 1232, 1242, 1243
- binding glutamic acid: 139, 145, 187, 243, 257, 264, 280
- binding nicotinamide-adenine-dinucleotide: 42, 44, 45, 76, 79, 107, 108, 109, 112, 132, 133, 135, 139, 140, 145, 154, 175, 176, 177, 180, 280
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: 874, 923, 924, 979, 1277, 1279, 1323, 1327, 1348, 1368, 1526
- binding zinc ion: 187, 264, 280
7tbuA Crystal structure of the 5-enolpyruvate-shikimate-3-phosphate synthase (epsps) domain of aro1 from candida albicans in complex with shikimate-3-phosphate (see paper)
38% identity, 63% coverage: 22:441/667 of query aligns to 21:446/450 of 7tbuA
7m0oA Dgt-28 epsps (see paper)
36% identity, 63% coverage: 21:442/667 of query aligns to 2:400/400 of 7m0oA
2cmkA Cytidine monophosphate kinase in complex with cytidine-di-phosphate (see paper)
46% identity, 32% coverage: 446:660/667 of query aligns to 4:220/221 of 2cmkA
Query Sequence
>WP_038205562.1 NCBI__GCF_000745855.1:WP_038205562.1
MFSIPSLDIPPLAGAAGRVRLPGSKSISNRVLLLAALSAGTTTIHDALDSDDTRVMLEAL
AQLGCGVTHEGPVLRIAGLGGRLQNTQASLFLGNAGTAMRPLTAALALLGGDFELSGVPR
MHERPIGDLVDALVQLGCHVDYLGNPGYPPLRIRPAALDTLQLDAPIRVRGDVSSQFLTA
LLMALPLAAQHQAIAIEVVGELISKPYIEITLNLLARFGIAVQREGWQRFVIPAGSRYAS
PGEIHVEADASSASYFIALGAIAAPASSPLRIDGVGADSIQGDIRFTEAARAMGAVIDSG
PNWLAVHRGAWPLKALDMDANAIPDAAMTLAVMALYADGPSTLRNIASWRVKETDRIDAM
AAELRKLGASVEAGPDFIRVMPLPAGGWHRASIHTYDDHRVAMCFSLAAFNPDALPVRIL
DPKCVGKTFPDYFETLFSVVRARSVPVICVDGPTASGKGTLAAELARRLGYHYLDSGALY
RIAGLVMRRAGLETSAQDEPRIAAELQGLDLRFDAGSVLLRGEDVTDAIRTEAAGMDASR
VSALPAVREALRALQLDFRRLPGLVADGRDMGTVIFPDAPLKVYLTASAAHRAERRHKQL
ISKGIPAMLDSLRADLEARDARDASRSVAPLKPAEDARLLDNSEQTVDQSVEQVLAWWRQ
VQPFDDA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory