SitesBLAST
Comparing WP_038209742.1 NCBI__GCF_000745855.1:WP_038209742.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A9T0 D-3-phosphoglycerate dehydrogenase; PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Escherichia coli (strain K12) (see 2 papers)
61% identity, 99% coverage: 4:410/410 of query aligns to 3:410/410 of P0A9T0
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1ybaA The active form of phosphoglycerate dehydrogenase (see paper)
61% identity, 99% coverage: 6:410/410 of query aligns to 1:406/406 of 1ybaA
- active site: N104 (= N109), R236 (= R241), D260 (= D265), E265 (= E270), H288 (= H293)
- binding 2-oxoglutaric acid: R56 (= R61), S57 (= S62), C79 (= C84), I80 (= I85)
- binding nicotinamide-adenine-dinucleotide: I80 (= I85), F102 (≠ Y107), V108 (= V113), G154 (= G159), G156 (= G161), H157 (≠ S162), I158 (= I163), Y176 (= Y181), D177 (= D182), I178 (≠ V183), K181 (≠ R186), H206 (= H211), V207 (= V212), P208 (= P213), A234 (= A239), S235 (= S240), R236 (= R241), H288 (= H293), G290 (= G295)
- binding phosphate ion: G81 (= G86), N83 (= N88)
2p9eA Crystal structure of g336v mutant of e.Coli phosphoglycerate dehydrogenase (see paper)
62% identity, 99% coverage: 6:410/410 of query aligns to 1:406/406 of 2p9eA
- active site: N104 (= N109), R236 (= R241), D260 (= D265), E265 (= E270), H288 (= H293)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G156 (= G161), H157 (≠ S162), I158 (= I163), Y176 (= Y181), D177 (= D182), I178 (≠ V183), H206 (= H211), V207 (= V212), P208 (= P213), S212 (= S217), A234 (= A239), S235 (= S240), R236 (= R241), H288 (= H293), G290 (= G295)
1psdA The allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase (see paper)
61% identity, 98% coverage: 8:410/410 of query aligns to 1:404/404 of 1psdA
- active site: N102 (= N109), R234 (= R241), D258 (= D265), E263 (= E270), H286 (= H293)
- binding nicotinamide-adenine-dinucleotide: N102 (= N109), H155 (≠ S162), I156 (= I163), D175 (= D182), I176 (≠ V183), K179 (≠ R186), H204 (= H211), V205 (= V212), P206 (= P213), A232 (= A239), S233 (= S240), R234 (= R241), H286 (= H293)
- binding serine: H338 (= H346), N340 (= N348), R341 (≠ V349), V344 (= V352)
1sc6D Crystal structure of w139g d-3-phosphoglycerate dehydrogenase complexed with NAD+ (see paper)
58% identity, 98% coverage: 8:410/410 of query aligns to 1:384/384 of 1sc6D
- active site: N102 (= N109), R228 (= R241), D252 (= D265)
- binding nicotinamide-adenine-dinucleotide: P99 (= P106), F100 (≠ Y107), N102 (= N109), T103 (= T110), G146 (= G159), G148 (= G161), H149 (≠ S162), I150 (= I163), Y168 (= Y181), D169 (= D182), I170 (≠ V183), H198 (= H211), V199 (= V212), P200 (= P213), S204 (= S217), T205 (= T218), S227 (= S240)
P87228 Putative D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
50% identity, 97% coverage: 12:410/410 of query aligns to 56:466/466 of P87228
- S87 (≠ D44) modified: Phosphoserine
- S258 (≠ L215) modified: Phosphoserine
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
39% identity, 74% coverage: 12:315/410 of query aligns to 1:300/304 of 1wwkA
- active site: S96 (≠ N109), R230 (= R241), D254 (= D265), E259 (= E270), H278 (= H293)
- binding nicotinamide-adenine-dinucleotide: V100 (= V113), G146 (= G159), F147 (≠ Y160), G148 (= G161), R149 (≠ S162), I150 (= I163), Y168 (= Y181), D169 (= D182), P170 (= P188), V201 (= V212), P202 (= P213), T207 (= T218), T228 (≠ A239), S229 (= S240), D254 (= D265), H278 (= H293), G280 (= G295)
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
32% identity, 77% coverage: 13:327/410 of query aligns to 8:317/533 of O43175
- T78 (≠ I85) binding
- R135 (≠ K142) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ SI 162:163) binding
- D175 (= D182) binding
- T207 (≠ V212) binding
- CAR 234:236 (≠ ASR 239:241) binding
- D260 (= D265) binding
- V261 (= V266) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HIGG 293:296) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
33% identity, 74% coverage: 13:314/410 of query aligns to 3:299/301 of 6rj5A
7dkmA Phgdh covalently linked to oridonin (see paper)
33% identity, 74% coverage: 13:314/410 of query aligns to 4:300/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ I85), A102 (≠ V113), G148 (= G159), R151 (≠ S162), I152 (= I163), Y170 (= Y181), D171 (= D182), P172 (≠ V183), I173 (≠ V184), H202 (= H211), T203 (≠ V212), P204 (= P213), T209 (= T218), C230 (≠ A239), A231 (≠ S240), R232 (= R241), H279 (= H293), G281 (= G295)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: C14 (≠ S23), K17 (≠ E26), I18 (≠ L27), E293 (≠ V307)
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
33% identity, 74% coverage: 13:314/410 of query aligns to 2:298/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (= N109), A100 (≠ V113), R149 (≠ S162), I150 (= I163), Y168 (= Y181), D169 (= D182), P170 (≠ V183), I171 (≠ V184), H200 (= H211), T201 (≠ V212), P202 (= P213), T207 (= T218), C228 (≠ A239), A229 (≠ S240), R230 (= R241), H277 (= H293), G279 (= G295)
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
33% identity, 74% coverage: 13:314/410 of query aligns to 4:300/305 of 6plfA
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
33% identity, 74% coverage: 13:314/410 of query aligns to 3:299/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ V158), G147 (= G159), L148 (≠ Y160), G149 (= G161), R150 (≠ S162), I151 (= I163), G152 (= G164), D170 (= D182), H201 (= H211), T202 (≠ V212), P203 (= P213)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
33% identity, 74% coverage: 13:314/410 of query aligns to 3:299/302 of 6rihA
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
33% identity, 74% coverage: 13:314/410 of query aligns to 3:299/303 of 6plgA
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
33% identity, 73% coverage: 13:310/410 of query aligns to 2:294/297 of 6rj3A
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
33% identity, 73% coverage: 15:314/410 of query aligns to 2:296/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G161), I148 (= I163), Y166 (= Y181), D167 (= D182), P168 (≠ V183), I169 (≠ V184), I170 (≠ T185), H198 (= H211), T199 (≠ V212), L208 (≠ M221), R228 (= R241)
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
38% identity, 73% coverage: 15:313/410 of query aligns to 5:297/526 of 3dc2A
Sites not aligning to the query:
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
38% identity, 73% coverage: 15:313/410 of query aligns to 6:298/525 of 3ddnB
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
31% identity, 80% coverage: 11:338/410 of query aligns to 2:332/334 of 5aovA
- active site: L100 (≠ N109), R241 (= R241), D265 (= D265), E270 (= E270), H288 (= H293)
- binding glyoxylic acid: M52 (≠ R61), L53 (≠ S62), L53 (≠ S62), Y74 (≠ F83), A75 (≠ C84), V76 (≠ I85), G77 (= G86), R241 (= R241), H288 (= H293)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ I85), T104 (≠ V113), F158 (≠ Y160), G159 (= G161), R160 (≠ S162), I161 (= I163), S180 (≠ D182), R181 (≠ V183), A211 (≠ H211), V212 (= V212), P213 (= P213), T218 (= T218), I239 (≠ A239), A240 (≠ S240), R241 (= R241), H288 (= H293), G290 (= G295)
Query Sequence
>WP_038209742.1 NCBI__GCF_000745855.1:WP_038209742.1
MTTKTSLDKSKIKFLLLEGIHPSGVELIRAAGYSQVEVLSGALDAEELKARVADVHFLGI
RSRTQLTPEIFAAARRLVAVGAFCIGTNQIDLGAALEHGVAVFNAPYSNTRSVAELVLAE
AILLLRGVPEKNAVAHRGGWLKSAENAFEIRGKTLGIVGYGSIGAQLSVLAEALGMHVVF
YDVVTRLPLGNAQQVRSLNELLGTADIVSLHVPQLPSTQWMIGEAQIAAMKPGAILINAS
RGTVVEIEPLAAAIRAKKLLGAAVDVFPVEPKSNKDEFVSPLRGLDNVILTPHIGGSTME
AQANIGVEVAEKLVKYSDNGTTTSSVNFPEVALPAHPGKHRLLHVHRNVPGVLSAVNGVF
AETGINISAQYLQTNEKVGYVVTDIDAGSSEAALEKLTQVPGTIRSWVLF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory