Comparing WP_038212450.1 NCBI__GCF_000745855.1:WP_038212450.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4k28A 2.15 angstrom resolution crystal structure of a shikimate dehydrogenase family protein from pseudomonas putida kt2440 in complex with NAD+ (see paper)
30% identity, 83% coverage: 6:260/306 of query aligns to 2:255/266 of 4k28A
P43876 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see paper)
29% identity, 83% coverage: 9:262/306 of query aligns to 2:250/272 of P43876
7colA Crystal structure of 5-ketofructose reductase complexed with NADPH (see paper)
33% identity, 76% coverage: 26:257/306 of query aligns to 23:252/280 of 7colA
3tozA 2.2 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with NAD.
25% identity, 92% coverage: 4:286/306 of query aligns to 9:291/291 of 3tozA
Q8Y9N5 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
25% identity, 92% coverage: 4:286/306 of query aligns to 9:291/291 of Q8Y9N5
1p77A Crystal structure of shikimate dehydrogenase (aroe) from haemophilus influenzae (see paper)
27% identity, 83% coverage: 9:262/306 of query aligns to 2:243/265 of 1p77A
3tnlA 1.45 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with shikimate and NAD.
25% identity, 92% coverage: 4:286/306 of query aligns to 6:288/288 of 3tnlA
2hk9B Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
25% identity, 86% coverage: 4:265/306 of query aligns to 2:250/267 of 2hk9B
2hk9A Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
25% identity, 86% coverage: 4:265/306 of query aligns to 2:250/269 of 2hk9A
O67049 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Aquifex aeolicus (strain VF5) (see paper)
25% identity, 86% coverage: 4:265/306 of query aligns to 2:250/269 of O67049
P15770 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Escherichia coli (strain K12) (see paper)
26% identity, 88% coverage: 9:276/306 of query aligns to 2:265/272 of P15770
1nytA Shikimate dehydrogenase aroe complexed with NADP+ (see paper)
26% identity, 88% coverage: 9:276/306 of query aligns to 2:265/271 of 1nytA
3pgjA 2.49 angstrom resolution crystal structure of shikimate 5- dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate
25% identity, 83% coverage: 9:262/306 of query aligns to 2:249/272 of 3pgjA
Q9KVT3 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
25% identity, 83% coverage: 9:262/306 of query aligns to 6:253/278 of Q9KVT3
Q5HNV1 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Staphylococcus epidermidis (strain ATCC 35984 / RP62A) (see paper)
22% identity, 84% coverage: 11:266/306 of query aligns to 3:248/269 of Q5HNV1
3sefA 2.4 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate and NADPH
27% identity, 67% coverage: 58:262/306 of query aligns to 46:245/268 of 3sefA
2cy0A Crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with NADP (see paper)
31% identity, 67% coverage: 61:265/306 of query aligns to 52:243/262 of 2cy0A
2ev9B Crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with NADP(h) and shikimate (see paper)
31% identity, 67% coverage: 61:265/306 of query aligns to 52:243/263 of 2ev9B
Sites not aligning to the query:
Q5SJF8 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
31% identity, 67% coverage: 61:265/306 of query aligns to 52:243/263 of Q5SJF8
Sites not aligning to the query:
3dooA Crystal structure of shikimate dehydrogenase from staphylococcus epidermidis complexed with shikimate (see paper)
22% identity, 84% coverage: 11:266/306 of query aligns to 3:239/258 of 3dooA
>WP_038212450.1 NCBI__GCF_000745855.1:WP_038212450.1
MADIHGNTDLYLIPGDPVTNVRLPRMFNAVFDRCGIAARMLPVQVRARDFAVWLKASFLA
RNVKGMVIAPPHKPLAVDLLDGCGLFARIAGSVNVVRRTHTGDLEGDLFDGEGIVGALDR
FGIPFRGRRVLILGAGVSAAAIGVSLAEGGGDDGAGHIAFYDPAPGKSAGVAARIDDAFD
ARVVAVPSADPAGYDLVINGTSVGLSEGDPLPCDVARMEPHAALFDILLRNQPTPLVRAA
RARGLHAQPGFEMLVQQMAHYFDYFALPQAGALVRQDADFLRELIYPPALAGEIRNPWRY
PDAGPR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory