Comparing WP_038212599.1 NCBI__GCF_000745855.1:WP_038212599.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q58761 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
30% identity, 91% coverage: 11:289/306 of query aligns to 9:284/284 of Q58761
1u9zA Crystal structure of phosphoribosyl diphosphate synthase complexed with amp and ribose 5-phosphate (see paper)
28% identity, 91% coverage: 11:289/306 of query aligns to 9:274/274 of 1u9zA
3lpnA Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with an atp analog (ampcpp). (see paper)
28% identity, 91% coverage: 5:281/306 of query aligns to 3:273/284 of 3lpnA
3mbiD Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with adp-mg2+ and ribose 5- phosphate (see paper)
28% identity, 91% coverage: 5:281/306 of query aligns to 3:273/285 of 3mbiD
3mbiA Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with adp-mg2+ and ribose 5- phosphate (see paper)
28% identity, 91% coverage: 5:281/306 of query aligns to 5:275/287 of 3mbiA
Q97CA5 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) (see paper)
28% identity, 91% coverage: 5:281/306 of query aligns to 3:273/286 of Q97CA5
Q97Z86 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
31% identity, 85% coverage: 13:272/306 of query aligns to 11:271/291 of Q97Z86
4twbA Sulfolobus solfataricus ribose-phosphate pyrophosphokinase (see paper)
30% identity, 85% coverage: 13:272/306 of query aligns to 11:258/278 of 4twbA
P14193 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PPRibP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Bacillus subtilis (strain 168) (see 4 papers)
25% identity, 94% coverage: 5:291/306 of query aligns to 12:305/317 of P14193
Sites not aligning to the query:
1dkuA Crystal structures of bacillus subtilis phosphoribosylpyrophosphate synthetase: molecular basis of allosteric inhibition and activation. (see paper)
25% identity, 94% coverage: 5:291/306 of query aligns to 4:284/295 of 1dkuA
Sites not aligning to the query:
P60891 Ribose-phosphate pyrophosphokinase 1; PPRibP; Phosphoribosyl pyrophosphate synthase I; PRS-I; EC 2.7.6.1 from Homo sapiens (Human) (see 5 papers)
25% identity, 90% coverage: 1:275/306 of query aligns to 1:278/318 of P60891
1ibsA Phosphoribosyldiphosphate synthetase in complex with cadmium ions (see paper)
24% identity, 94% coverage: 5:291/306 of query aligns to 4:286/297 of 1ibsA
1ibsB Phosphoribosyldiphosphate synthetase in complex with cadmium ions (see paper)
24% identity, 94% coverage: 5:291/306 of query aligns to 6:288/299 of 1ibsB
7pn0A Crystal structure of the phosphorybosylpyrophosphate synthetase ii from thermus thermophilus at r32 space group
29% identity, 95% coverage: 2:291/306 of query aligns to 2:296/312 of 7pn0A
8dbkB Human prps1 with phosphate, atp, and r5p; hexamer with resolved catalytic loops (see paper)
26% identity, 86% coverage: 12:275/306 of query aligns to 12:277/316 of 8dbkB
8dbeA Human prps1 with adp; hexamer (see paper)
26% identity, 86% coverage: 12:275/306 of query aligns to 12:277/316 of 8dbeA
Sites not aligning to the query:
5t3oA Crystal structure of the phosphorybosylpyrophosphate synthetase ii from thermus thermophilus (see paper)
29% identity, 95% coverage: 2:291/306 of query aligns to 1:295/307 of 5t3oA
2hcrA Crystal structure of human phosphoribosyl pyrophosphate synthetase 1 in complex with amp(atp), cadmium and sulfate ion (see paper)
26% identity, 87% coverage: 9:275/306 of query aligns to 8:270/305 of 2hcrA
8dbgA Human prps1 with phosphate and atp; hexamer (see paper)
25% identity, 87% coverage: 10:275/306 of query aligns to 10:270/309 of 8dbgA
7yk1A Structural basis of human prps2 filaments (see paper)
24% identity, 90% coverage: 2:275/306 of query aligns to 1:268/306 of 7yk1A
Sites not aligning to the query:
>WP_038212599.1 NCBI__GCF_000745855.1:WP_038212599.1
MPRLVLPLPGNEGFAARLAEAAGAELGRLETRRFPDGESYVRLLADPAGRAVDLVCTLAD
PDAGFLRLAFAADAARDLGAAEVNLVAPYLAYMRQDRRFLDGESVSSRTFARLVSCTFDR
VVTVDPHLHRHPALQGLYTVPTATLHAAPLLADWIAAHVRAPLIVGPDEESEQWAGAIAR
RIGAPHAVLRKTRHGDRSVDVAAPDLSAWRERTPVLVDDIASSGRTLAAAAQQLAAQGLP
PAECVVVHALFAQDAWAQLAPHFARIISTDTVPHRSNGIGLAPLAADALLRGVQDPPAGP
HMKGTA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory