Comparing WP_039653499.1 NCBI__GCF_000816635.1:WP_039653499.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
P09323 PTS system N-acetylglucosamine-specific EIICBA component; EIICBA-Nag; EII-Nag; EC 2.7.1.193 from Escherichia coli (strain K12) (see paper)
41% identity, 97% coverage: 4:651/667 of query aligns to 2:631/648 of P09323
Sites not aligning to the query:
P69786 PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 from Escherichia coli (strain K12) (see 5 papers)
42% identity, 74% coverage: 1:491/667 of query aligns to 1:476/477 of P69786
8qsrA Cryo-em structure of the glucose-specific pts transporter iicb from e. Coli in the inward-facing conformation (see paper)
42% identity, 59% coverage: 6:399/667 of query aligns to 3:383/383 of 8qsrA
6bvgA Crystal structure of bcmalt t280c-e54c crosslinked by divalent mercury (see paper)
29% identity, 59% coverage: 6:399/667 of query aligns to 2:442/447 of 6bvgA
P69783 PTS system glucose-specific EIIA component; EIIA-Glc; EIII-Glc; Glucose-specific phosphotransferase enzyme IIA component from Escherichia coli (strain K12) (see 6 papers)
45% identity, 20% coverage: 510:643/667 of query aligns to 12:145/169 of P69783
Sites not aligning to the query:
1glcF Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
46% identity, 18% coverage: 521:643/667 of query aligns to 15:137/161 of 1glcF
1o2fA Complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
46% identity, 18% coverage: 521:643/667 of query aligns to 4:126/150 of 1o2fA
1o2fB Complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
48% identity, 11% coverage: 418:491/667 of query aligns to 3:77/77 of 1o2fB
>WP_039653499.1 NCBI__GCF_000816635.1:WP_039653499.1
MKKKIFSVLQKIGKSLMLPVSVLPAAGILLRLGQPDLLNMPYIEAAGNAIFTNLPMIFAV
GVAIGFSGGEAVAALAAVVGELILENIEKLASSNAATALAQTTAASHHMTLKAFMETQVY
QNIVTKTTINMGVFGGIIIGIVAALLYNRFHSIKLPQVLGFFGGKRFVPIVTSAAALIIG
AIGVSIWVPVQGWIDTMANLASNSALGPAFYAAGKRLLIPVGLHHIYYPVFLYQFGHFIS
NGITYIGDSPRYFHGDPTAGIFMASEFPILMFGLPGAALAMIAAAKKSKRKQMAGMMISS
AFVAFVTGITEPIEFSFIFVAPILFVFHVLVAFCSGLVTSFLHIRLGYTFSASFIDYILG
FRYAEHPWLIWPVGVAFFLLYFVVFYFLIRAMNLKTPGREDEDGEEIVHINVKGSAKAAK
VLEAIGGKDNIKVLDACITRLRLTLNDPAVDEKTLRALGAAGIMKAGNSVQVVFGTEAER
IKDDIKAIIANGGVVEESETQQGEDTSGGSESKAVSGVNLLLSPADGEIVTLEEVPDPTF
SEKLLGDGFAVIPSGDNIYAPADGEITVLFPTKHAFAITTAQGLELLIHIGIDTVALNGE
GFTAHVKQGDKVKKGDLILNLDSKFIKSKGKNMITPVIVTNMDIVDNIDIKKGKVDHAKT
AAEILIK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory