SitesBLAST
Comparing WP_040184467.1 NCBI__GCF_000821105.2:WP_040184467.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9YHT2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial; Iron-sulfur subunit of complex II; Ip; Malate dehydrogenase [quinone] iron-sulfur subunit; EC 1.3.5.1; EC 1.1.5.- from Gallus gallus (Chicken) (see 2 papers)
31% identity, 25% coverage: 7:108/414 of query aligns to 178:278/290 of Q9YHT2
- C196 (= C25) binding [4Fe-4S] cluster
- C199 (= C28) binding [4Fe-4S] cluster
- C202 (= C31) binding [4Fe-4S] cluster
- C206 (= C35) binding [3Fe-4S] cluster
- W211 (≠ L40) binding a ubiquinone
- C253 (= C79) binding [3Fe-4S] cluster
- C259 (= C85) binding [3Fe-4S] cluster
- C263 (= C89) binding [4Fe-4S] cluster
Sites not aligning to the query:
- 103 binding [2Fe-2S] cluster
- 108 binding [2Fe-2S] cluster
- 111 binding [2Fe-2S] cluster
- 123 binding [2Fe-2S] cluster
Q007T0 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial; Iron-sulfur subunit of complex II; Ip; Malate dehydrogenase [quinone] iron-sulfur subunit; EC 1.3.5.1; EC 1.1.5.- from Sus scrofa (Pig) (see paper)
31% identity, 25% coverage: 7:110/414 of query aligns to 168:270/280 of Q007T0
- C186 (= C25) binding [4Fe-4S] cluster
- C189 (= C28) binding [4Fe-4S] cluster
- C192 (= C31) binding [4Fe-4S] cluster
- C196 (= C35) binding [3Fe-4S] cluster
- W201 (≠ L40) binding a ubiquinone
- C243 (= C79) binding [3Fe-4S] cluster
- C249 (= C85) binding [3Fe-4S] cluster
- C253 (= C89) binding [4Fe-4S] cluster
Sites not aligning to the query:
- 93 binding [2Fe-2S] cluster
- 98 binding [2Fe-2S] cluster
- 101 binding [2Fe-2S] cluster
- 113 binding [2Fe-2S] cluster
P21912 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial; Iron-sulfur subunit of complex II; Ip; Malate dehydrogenase [quinone] iron-sulfur subunit; EC 1.3.5.1; EC 1.1.5.- from Homo sapiens (Human) (see 10 papers)
31% identity, 25% coverage: 7:108/414 of query aligns to 168:268/280 of P21912
- C186 (= C25) binding [4Fe-4S] cluster
- C189 (= C28) binding [4Fe-4S] cluster
- C192 (= C31) binding [4Fe-4S] cluster
- C196 (= C35) binding [3Fe-4S] cluster
- W201 (≠ L40) binding a ubiquinone
- C243 (= C79) binding [3Fe-4S] cluster
- C249 (= C85) binding [3Fe-4S] cluster
- C253 (= C89) binding [4Fe-4S] cluster
- L257 (≠ V93) to V: in MC2DN4; decreased succinate dehydrogenase (ubiquinone) activity; decreased protein levels in homozygous patient cells; dbSNP:rs761350633
Sites not aligning to the query:
- 3 A → G: found in a patient with a Cowden-like phenotype; uncertain significance; patient cells have increased manganese superoxide dismutase expression and normal levels of reactive oxygen species; 1.2-fold increase in AKT expression and 1.3-fold change in MAPK expression in patient cells; dbSNP:rs11203289
- 40 natural variant: K -> E
- 48 D → V: in MC2DN4; decreased succinate dehydrogenase (ubiquinone) activity in homozygous patient cells; decreased protein levels in homozygous patient cells; dbSNP:rs202101384
- 93 binding [2Fe-2S] cluster
- 98 binding [2Fe-2S] cluster
- 100 S → F: in PPGL4; absence of expression in tumor cells indicating complete loss of SDHB function; dbSNP:rs121917755
- 101 binding [2Fe-2S] cluster
- 102 A → T: in MC2DN4; uncertain significance; dbSNP:rs777578399
- 113 binding [2Fe-2S] cluster
- 146:218 Interaction with SDHAF1
- 163 S → P: found in a patient with a Cowden-like phenotype; uncertain significance; patient cells have increased manganese superoxide dismutase expression and increased levels of reactive oxygen species; 2.7-fold increase in AKT expression and a 1.7-fold increase in MAPK expression; dbSNP:rs33927012
8gs8B Cryo-em structure of the human respiratory complex ii (see paper)
33% identity, 22% coverage: 16:108/414 of query aligns to 143:234/239 of 8gs8B
- binding fe3-s4 cluster: C162 (= C35), Y172 (≠ R45), P175 (= P48), C209 (= C79), H210 (≠ L80), T211 (= T81), I212 (≠ C82), M213 (≠ L83), N214 (= N84), C215 (= C85)
- binding iron/sulfur cluster: C152 (= C25), C155 (= C28), C158 (= C31), A176 (≠ R49), C219 (= C89)
- binding ubiquinone-1: P163 (= P36), W167 (≠ L40), I212 (≠ C82)
Sites not aligning to the query:
1yq3B Avian respiratory complex ii with oxaloacetate and ubiquinone (see paper)
31% identity, 25% coverage: 7:110/414 of query aligns to 135:237/242 of 1yq3B
- binding fe3-s4 cluster: C163 (= C35), Y173 (≠ R45), P176 (= P48), C210 (= C79), T212 (= T81), I213 (≠ C82), M214 (≠ L83), N215 (= N84), C216 (= C85)
- binding iron/sulfur cluster: C153 (= C25), I154 (≠ V26), L155 (≠ H27), C156 (= C28), A157 (≠ G29), C159 (= C31), A177 (≠ R49), C220 (= C89), P221 (= P90)
- binding Coenzyme Q10, (2Z,6E,10Z,14E,18E,22E,26Z)-isomer: P164 (= P36), W168 (≠ L40), I213 (≠ C82)
Sites not aligning to the query:
3sfeB Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and thiabendazole (see paper)
33% identity, 23% coverage: 16:110/414 of query aligns to 142:235/240 of 3sfeB
- binding fe3-s4 cluster: C161 (= C35), Y171 (≠ R45), P174 (= P48), C208 (= C79), T210 (= T81), I211 (≠ C82), M212 (≠ L83), N213 (= N84), C214 (= C85)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), A155 (≠ G29), C157 (= C31), A175 (≠ R49), C218 (= C89), P219 (= P90), K220 (≠ S91), L222 (≠ V93)
- binding 2-(1,3-thiazol-4-yl)-1h-benzimidazole: H209 (≠ L80), I211 (≠ C82)
Sites not aligning to the query:
3sfdB Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and pentachlorophenol (see paper)
33% identity, 23% coverage: 16:110/414 of query aligns to 141:234/239 of 3sfdB
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ R45), P173 (= P48), C207 (= C79), T209 (= T81), I210 (≠ C82), M211 (≠ L83), N212 (= N84), C213 (= C85)
- binding pentachlorophenol: P161 (= P36), W165 (≠ L40), I210 (≠ C82)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), A154 (≠ G29), C156 (= C31), A174 (≠ R49), C217 (= C89), P218 (= P90), K219 (≠ S91)
Sites not aligning to the query:
3aegB Crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-iodo-benzamide
33% identity, 23% coverage: 16:110/414 of query aligns to 141:234/239 of 3aegB
- binding N-biphenyl-3-yl-2-iodobenzamide: S162 (≠ T37), W164 (≠ Q39), W165 (≠ L40), H208 (≠ L80)
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ R45), P173 (= P48), C207 (= C79), I210 (≠ C82), M211 (≠ L83), C213 (= C85), I227 (≠ V99)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), A154 (≠ G29), C156 (= C31), A174 (≠ R49), C217 (= C89)
Sites not aligning to the query:
3aeeB Crystal structure of porcine heart mitochondrial complex ii bound with atpenin a5
33% identity, 23% coverage: 16:110/414 of query aligns to 141:234/239 of 3aeeB
- binding 3-[(2s,4s,5r)-5,6-dichloro-2,4-dimethyl-1-oxohexyl]-4-hydroxy-5,6-dimethoxy-2(1h)-pyridinone: W165 (≠ L40), H208 (≠ L80), I210 (≠ C82)
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ R45), P173 (= P48), C207 (= C79), T209 (= T81), I210 (≠ C82), M211 (≠ L83), N212 (= N84), C213 (= C85)
- binding iron/sulfur cluster: C150 (= C25), L152 (≠ H27), C153 (= C28), C156 (= C31), A174 (≠ R49), C217 (= C89), P218 (= P90), L221 (≠ V93)
Sites not aligning to the query:
3aedB Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-phenyl-benzamide
33% identity, 23% coverage: 16:110/414 of query aligns to 141:234/239 of 3aedB
- binding 2-iodo-N-phenylbenzamide: P161 (= P36), W165 (≠ L40), H208 (≠ L80), I210 (≠ C82)
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ R45), P173 (= P48), C207 (= C79), I210 (≠ C82), M211 (≠ L83), N212 (= N84), C213 (= C85)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), A154 (≠ G29), C156 (= C31), C217 (= C89), L221 (≠ V93)
Sites not aligning to the query:
3aecB Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-(1-methylethyl)-benzamid
33% identity, 23% coverage: 16:110/414 of query aligns to 141:234/239 of 3aecB
- binding 2-iodo-N-(1-methylethyl)benzamide: P161 (= P36), W165 (≠ L40), H208 (≠ L80)
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ R45), P173 (= P48), C207 (= C79), I210 (≠ C82), M211 (≠ L83), N212 (= N84), C213 (= C85)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), C156 (= C31), A174 (≠ R49), C217 (= C89), P218 (= P90), L221 (≠ V93)
Sites not aligning to the query:
3aebB Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-phenoxy-phenyl)-2-trifluoromethyl-benzamide
33% identity, 23% coverage: 16:110/414 of query aligns to 141:234/239 of 3aebB
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ R45), P173 (= P48), C207 (= C79), T209 (= T81), I210 (≠ C82), M211 (≠ L83), N212 (= N84), C213 (= C85)
- binding N-(3-phenoxyphenyl)-2-(trifluoromethyl)benzamide: W165 (≠ L40), H208 (≠ L80)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), A154 (≠ G29), C156 (= C31), A174 (≠ R49), C217 (= C89), L221 (≠ V93)
Sites not aligning to the query:
3aeaB Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-dimethylaminomethyl-phenyl)-2-trifluoromethyl-benzamide (see paper)
33% identity, 23% coverage: 16:110/414 of query aligns to 141:234/239 of 3aeaB
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ R45), P173 (= P48), C207 (= C79), T209 (= T81), I210 (≠ C82), M211 (≠ L83), N212 (= N84), C213 (= C85)
- binding N-{3-[(dimethylamino)methyl]phenyl}-2-(trifluoromethyl)benzamide: P161 (= P36), W165 (≠ L40), H208 (≠ L80), I210 (≠ C82)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), C156 (= C31), A174 (≠ R49), C217 (= C89), P218 (= P90), L221 (≠ V93)
Sites not aligning to the query:
3ae9B Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-pentafluorophenyloxy-phenyl)-2-trifluoromethyl-benzamide (see paper)
33% identity, 23% coverage: 16:110/414 of query aligns to 141:234/239 of 3ae9B
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ R45), P173 (= P48), C207 (= C79), H208 (≠ L80), T209 (= T81), I210 (≠ C82), M211 (≠ L83), N212 (= N84), C213 (= C85)
- binding N-[3-(pentafluorophenoxy)phenyl]-2-(trifluoromethyl)benzamide: P161 (= P36), W165 (≠ L40), H208 (≠ L80)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), A154 (≠ G29), C156 (= C31), A174 (≠ R49), C217 (= C89), L221 (≠ V93)
Sites not aligning to the query:
3ae8B Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-isopropoxy-phenyl)-2-trifluoromethylbenzamide
33% identity, 23% coverage: 16:110/414 of query aligns to 141:234/239 of 3ae8B
- binding fe3-s4 cluster: C160 (= C35), P173 (= P48), C207 (= C79), T209 (= T81), I210 (≠ C82), M211 (≠ L83), C213 (= C85)
- binding N-[3-(1-methylethoxy)phenyl]-2-(trifluoromethyl)benzamide: S162 (≠ T37), W165 (≠ L40), H208 (≠ L80)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), C156 (= C31), A174 (≠ R49), C217 (= C89), P218 (= P90), L221 (≠ V93)
Sites not aligning to the query:
3ae7B Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-(3-isopropoxy-phenyl)-benzamide (see paper)
33% identity, 23% coverage: 16:110/414 of query aligns to 141:234/239 of 3ae7B
- binding 2-iodo-N-[3-(1-methylethoxy)phenyl]benzamide: P161 (= P36), W165 (≠ L40), H208 (≠ L80), I210 (≠ C82)
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ R45), P173 (= P48), C207 (= C79), T209 (= T81), I210 (≠ C82), M211 (≠ L83), C213 (= C85)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), C156 (= C31), A174 (≠ R49), C217 (= C89), P218 (= P90)
Sites not aligning to the query:
3ae6B Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-isopropoxy-phenyl)-phthalamicacid
33% identity, 23% coverage: 16:110/414 of query aligns to 141:234/239 of 3ae6B
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ R45), P173 (= P48), C207 (= C79), I210 (≠ C82), M211 (≠ L83), N212 (= N84), C213 (= C85)
- binding 2-{[3-(1-methylethoxy)phenyl]carbamoyl}benzoic acid: S162 (≠ T37), W165 (≠ L40)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), A154 (≠ G29), C156 (= C31), A174 (≠ R49), C217 (= C89), P218 (= P90), L221 (≠ V93)
Sites not aligning to the query:
3ae4B Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-methyl-benzamide
33% identity, 23% coverage: 16:110/414 of query aligns to 141:234/239 of 3ae4B
- binding fe3-s4 cluster: C160 (= C35), S162 (≠ T37), P173 (= P48), C207 (= C79), M211 (≠ L83), N212 (= N84), C213 (= C85)
- binding 2-iodo-N-methylbenzamide: W165 (≠ L40), H208 (≠ L80), I210 (≠ C82)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), C153 (= C28), A154 (≠ G29), C156 (= C31), A174 (≠ R49), C217 (= C89), P218 (= P90)
Sites not aligning to the query:
3ae3B Crystal structure of porcine heart mitochondrial complex ii bound with 2-nitro-n-phenyl-benzamide
33% identity, 23% coverage: 16:110/414 of query aligns to 141:234/239 of 3ae3B
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ R45), P173 (= P48), C207 (= C79), T209 (= T81), I210 (≠ C82), M211 (≠ L83), N212 (= N84), C213 (= C85)
- binding 2-nitro-N-phenylbenzamide: P161 (= P36), S162 (≠ T37), W165 (≠ L40), H208 (≠ L80)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), A154 (≠ G29), C156 (= C31), C217 (= C89), P218 (= P90), L221 (≠ V93)
Sites not aligning to the query:
3ae1B Crystal structure of porcine heart mitochondrial complex ii bound with n-phenyl-2-(trifluoromethyl)-benzamide
33% identity, 23% coverage: 16:110/414 of query aligns to 141:234/239 of 3ae1B
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ R45), P173 (= P48), C207 (= C79), T209 (= T81), I210 (≠ C82), M211 (≠ L83), N212 (= N84), C213 (= C85)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), A154 (≠ G29), C156 (= C31), A174 (≠ R49), C217 (= C89), K219 (≠ S91), L221 (≠ V93)
- binding N-phenyl-2-(trifluoromethyl)benzamide: H208 (≠ L80), I210 (≠ C82)
Sites not aligning to the query:
Query Sequence
>WP_040184467.1 NCBI__GCF_000821105.2:WP_040184467.1
MQTHFTEEDLKKPHIREADRVLRTCVHCGFCNATCPTYQLLGDERDGPRGRIYLMKEMLE
SPDDDTQVTEETRLHLDRCLTCLNCETTCPSGVEYHKLVNIGRAEIERRVPRSLPERSLR
FGLRKALVEPRRFKALLKLGQTFKPLVPGTLRDKMPPAPVDAGARPEGKRHARQMLILEG
CVQPGLSPNTNAATARVLDRLGIGLTPAPEAGCCGAIDFHLNAQEAGRARMRANIDAWWP
HIEKEGEAGVEAIVQTASGCGAFVKEYGEMLADDPDYAHKAERISALARDLVEVLRDEDL
DALDIQERRRLAFHCPCTLQHAQKLGGAVEQVLGRLGFALTPVQDAHLCCGSAGTYSVTQ
PELATELRNNKLDNLEAGNPEVIVTANIGCQTHLAGANRTPVRHWIEIVDEALA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory