Comparing WP_040474509.1 NCBI__GCF_000170835.1:WP_040474509.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
7yleA Rndmpx in complex with dmsp (see paper)
60% identity, 93% coverage: 22:320/322 of query aligns to 1:298/299 of 7yleA
Q4FL33 Trimethylamine N-oxide-binding protein; TMAO-binding protein from Pelagibacter ubique (strain HTCC1062) (see paper)
22% identity, 95% coverage: 1:305/322 of query aligns to 1:310/314 of Q4FL33
2regA Abc-transporter choline binding protein in complex with choline (see paper)
22% identity, 91% coverage: 23:314/322 of query aligns to 5:275/290 of 2regA
2rinA Abc-transporter choline binding protein in complex with acetylcholine (see paper)
22% identity, 91% coverage: 23:314/322 of query aligns to 3:273/288 of 2rinA
Q5LT66 Trimethylamine N-oxide-binding protein; TMAO-binding protein from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) (Silicibacter pomeroyi) (see paper)
23% identity, 88% coverage: 26:309/322 of query aligns to 48:332/333 of Q5LT66
Sites not aligning to the query:
4xz6A Tmox in complex with tmao (see paper)
23% identity, 88% coverage: 26:309/322 of query aligns to 6:290/291 of 4xz6A
>WP_040474509.1 NCBI__GCF_000170835.1:WP_040474509.1
MRKLTPVALLCAMSVPALAQADCGEVSITEMGWASNTVVTSVAKFIMEQGYGCDVTVVPS
DTVPAVTSVAENGEPDIVTELWLNSAGEAYLELEEQGKIERLTKVLEPGGVEGWWIPTYL
AEKHPELTTIEGVMANPELVENRFNNCPSGWGCRVVSDNLIRALDLESSGIEVFNHGSGE
TLASSMASAVQSEEPWFGYYWGPTVPLGKFDMTRVELGDYKPEVHTRNQTQDADNPGVSE
FPAATVLTSVTTDFKDREPEVAEMLSKLTFKTDTMSALLAWMDSNNASAEEAAVYFLSNN
SDEWSSWLNDSAKKRLASVLGE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory