SitesBLAST
Comparing WP_040690304.1 NCBI__GCF_000341125.1:WP_040690304.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
P54582 Glycine betaine transporter BetP; Glycine betaine permease from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534) (see 6 papers)
42% identity, 88% coverage: 12:520/578 of query aligns to 69:578/595 of P54582
- W101 (= W46) mutation to A: Mainly monomeric, shows a decrease in activity and cannot be activated in response to increased osmolality; when associated with A-351.
- E135 (= E80) mutation to A: Strongly decreased betaine transport.
- G149 (= G94) mutation to A: Decreases betaine transport. No effect on activation by increased osmolality.
- M150 (= M95) mutation to F: No effect on activation by increased osmolality; when associated with A-152.
- G151 (= G96) mutation to A: Nearly abolishes betaine transport.
- I152 (= I97) mutation to A: No effect on activation by increased osmolality; when associated with F-150.
- IG 152:153 (= IG 97:98) binding glycine betaine
- G153 (= G98) mutation to A: Decreases betaine transport and alters activation at higher osmolality.; mutation to D: Changes substrate specificity, giving rise to proton-coupled choline transport. Decreases sodium-dependent betaine transport.
- F156 (= F101) mutation to A: Decreases betaine transport, but has no major effect on affinity for glycine betaine.
- W189 (= W137) mutation to C: Mildly decreased betaine transport.
- W194 (= W142) mutation to L: Strongly decreased betaine transport.
- Y197 (= Y145) mutation to L: Nearly abolishes betaine transport.
- R210 (= R158) mutation to A: Nearly abolishes betaine transport.
- S253 (= S201) binding glycine betaine
- G301 (= G249) mutation to L: Strongly decreased betaine transport.
- N309 (= N257) mutation to A: Decreases affinity for sodium ions.
- T351 (= T300) mutation to A: Mainly trimeric, but shows reduced activity at high osmolalities. Mainly monomeric, shows a decrease in activity and cannot be activated in response to increased osmolality; when associated with A-101.
- W362 (= W310) mutation to C: Strongly decreased betaine transport.
- W366 (= W314) mutation to C: No effect on betaine transport.
- F369 (= F317) mutation to G: Decreases affinity for glycine betaine. Decreases betaine transport.
- W371 (= W319) mutation to L: No effect on betaine transport.
- W373 (= W321) mutation to A: Strongly decreases affinity for glycine betaine and betaine transport.
- WWISW 373:377 (≠ WWMSW 321:325) binding glycine betaine
- W374 (= W322) mutation to A: Strongly decreases betaine transport, but has no major effect on affinity for glycine betaine.; mutation to L: No effect on betaine transport.
- W377 (= W325) mutation to A: Abolishes betaine transport.; mutation to L: Nearly abolishes betaine transport.
- F380 (= F328) mutation to A: Decreases betaine transport, but has no effect on affinity for glycine betaine.
- F384 (= F332) mutation to A: Decreases betaine transport, but has no effect on affinity for glycine betaine.
- R387 (= R335) mutation to A: Mildly decreased betaine transport.
- R392 (= R340) mutation to K: Moderately decreased betaine transport.
4llhA Substrate bound outward-open state of the symporter betp (see paper)
42% identity, 88% coverage: 12:520/578 of query aligns to 13:519/524 of 4llhA
- binding 2-(trimethyl-lambda~5~-arsanyl)ethanol: M94 (= M95), G95 (= G96), D97 (≠ G98), W314 (= W321), W315 (= W322), W318 (= W325)
- binding 5-cyclohexyl-1-pentyl-beta-d-maltoside: R495 (= R498), R499 (= R502)
- binding sodium ion: A91 (= A92), M94 (= M95), G95 (= G96), F405 (= F416), T408 (= T419), S409 (= S420)
3p03C Crystal structure of betp-g153d with choline bound (see paper)
42% identity, 87% coverage: 12:511/578 of query aligns to 13:507/508 of 3p03C
8ybqA Choline transporter bett - cht bound (see paper)
41% identity, 87% coverage: 2:501/578 of query aligns to 5:501/502 of 8ybqA
B4EY22 L-carnitine/gamma-butyrobetaine antiporter from Proteus mirabilis (strain HI4320) (see 2 papers)
29% identity, 87% coverage: 5:509/578 of query aligns to 12:514/514 of B4EY22
- E111 (= E106) mutation to A: Abolishes transport activity.
- R262 (≠ N257) mutation R->A,E: Strong decrease in L-carnitine transport. Mutant is Na(+)-dependent for substrate binding and transport.
- W316 (= W314) mutation to A: 2.5-fold decrease in Vmax.
- M331 (≠ V329) mutation to V: 10-fold decrease in Vmax.
2wswA Crystal structure of carnitine transporter from proteus mirabilis (see paper)
30% identity, 84% coverage: 5:488/578 of query aligns to 17:498/508 of 2wswA
4m8jA Crystal structure of cait r262e bound to gamma-butyrobetaine (see paper)
30% identity, 84% coverage: 5:488/578 of query aligns to 4:485/495 of 4m8jA
P31553 L-carnitine/gamma-butyrobetaine antiporter from Escherichia coli (strain K12) (see 3 papers)
29% identity, 85% coverage: 5:498/578 of query aligns to 12:503/504 of P31553
- Y114 (≠ N109) binding 4-(trimethylamino)butanoate; mutation to L: Small decrease in transport activity.
- W142 (= W137) binding (R)-carnitine
- D288 (≠ Q283) mutation to A: Retains 70% of transport activity. Forms mostly monomers.; mutation to R: Abolishes transport activity. Forms mostly monomers.; mutation to W: Retains 4% of transport activity. Forms mostly monomers.
- M295 (≠ Q290) mutation to E: Does not affect transport activity. Forms mostly monomers. Can also form small amounts of homodimers and homotrimers.
- R299 (= R294) mutation to A: Does not affect transport activity. Forms mostly monomers. Can also form small amounts of homodimers and homotrimers. Shows a high tendency to aggregate.
- T304 (= T299) mutation to A: Does not affect transport activity. Forms mostly monomers. Shows a high tendency to aggregate.
- GW 315:316 (= GW 312:313) binding 4-(trimethylamino)butanoate
- W316 (= W313) mutation to L: Decrease in transport activity.
- W323 (= W321) binding 4-(trimethylamino)butanoate; mutation to L: Abolishes transport activity.
- WW 323:324 (= WW 321:322) binding (R)-carnitine
- W324 (= W322) mutation to L: Abolishes transport activity.
- Y327 (≠ W325) mutation to L: Strong decrease in transport activity.
- YAIQ 327:330 (≠ WAPF 325:328) binding (R)-carnitine
- Q330 (≠ F328) mutation to L: Decrease in transport activity.
- M331 (≠ V329) binding 4-(trimethylamino)butanoate
3hfxA Crystal structure of carnitine transporter (see paper)
29% identity, 85% coverage: 5:498/578 of query aligns to 1:492/493 of 3hfxA
2wsxA Crystal structure of carnitine transporter from escherichia coli (see paper)
28% identity, 85% coverage: 5:498/578 of query aligns to 5:496/496 of 2wsxA
Query Sequence
>WP_040690304.1 NCBI__GCF_000341125.1:WP_040690304.1
MITAPRVFWPSVILVTIFVAFTAVFTDVVSTAITTLQDTVIGAFGWYYILIVCGFVVFSI
RVGLGRFGDIKLGPDDEEPEFKLGTWFSMLFAAGMGIGLVFWGVAEPLNHFASPKPGVEG
TSQELAQQSLVQTFLHWGLHPWAIYVVVGLAIAYAIHRKKRPVSIRWALEPLLGRRRVNG
WLGDLIDVVAVIGTLFGVATSLGLGVLQIASGLDVLGIVSDPGNWTNIVLIGGITALAIF
SVTTGVKRGVKWLSQINMGLAVVLMLIVLVTGPTLFLLREFVQSIGLYFQNLLRLSFDTT
ALEGQGGAQWQGWWTTFYWGWWMSWAPFVGVFIARISRGRTVREFVTGVLLVPTAVTFLW
LTVFGGSALYRELFGSGGGVAADGSVNTEGALFGLLGELPGGTVLVAGAVILIVLFFVTS
SDSGSLVVDMLASGGSHETPVWSRVFWAAAEGLVAITLLLAGGLSALQVGAILIALPFSV
VMLLMCVATWKQLGEERRRQIRAQRRMEREELTEHVSQNLLEGDEFTGQISQNLLEEGEF
TAQLSQNLIEEGWTDPNGEPNGADRSDTDDPDAVKDKV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory