Comparing WP_041097122.1 NCBI__GCF_000828635.1:WP_041097122.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ij6A Crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from hydrogenobacter thermophilus tk-6 in complex with l-phosphoserine (see paper)
28% identity, 87% coverage: 6:192/214 of query aligns to 1:187/207 of 4ij6A
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
30% identity, 94% coverage: 7:208/214 of query aligns to 2:204/207 of 1h2fA
Sites not aligning to the query:
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
30% identity, 94% coverage: 7:208/214 of query aligns to 2:204/207 of 1h2eA
P9WIC7 Glucosyl-3-phosphoglycerate phosphatase; Mannosyl-3-phosphoglycerate phosphatase; EC 3.1.3.85; EC 3.1.3.70 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
34% identity, 71% coverage: 5:157/214 of query aligns to 2:161/223 of P9WIC7
Sites not aligning to the query:
P62707 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Escherichia coli (strain K12) (see 6 papers)
38% identity, 45% coverage: 6:102/214 of query aligns to 3:104/250 of P62707
Sites not aligning to the query:
1e59A E.Coli cofactor-dependent phosphoglycerate mutase complexed with vanadate (see paper)
38% identity, 45% coverage: 6:102/214 of query aligns to 1:102/239 of 1e59A
Sites not aligning to the query:
4pzaB The complex structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c with inorganic phosphate (see paper)
34% identity, 71% coverage: 5:157/214 of query aligns to 1:160/217 of 4pzaB
4qihA The structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 (see paper)
34% identity, 70% coverage: 8:157/214 of query aligns to 3:159/209 of 4qihA
Q7ZVE3 Fructose-2,6-bisphosphatase TIGAR B; TP53-induced glycolysis and apoptosis regulator B; EC 3.1.3.46 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
35% identity, 64% coverage: 9:144/214 of query aligns to 6:142/257 of Q7ZVE3
Q9NQ88 Fructose-2,6-bisphosphatase TIGAR; TP53-induced glycolysis and apoptosis regulator; TP53-induced glycolysis regulatory phosphatase; EC 3.1.3.46 from Homo sapiens (Human) (see 4 papers)
39% identity, 50% coverage: 12:117/214 of query aligns to 9:119/270 of Q9NQ88
Sites not aligning to the query:
3gp3A Crystal structure of phosphoglyceromutase from burkholderia pseudomallei with 2-phosphoserine (see paper)
35% identity, 46% coverage: 6:104/214 of query aligns to 1:104/229 of 3gp3A
Sites not aligning to the query:
3fdzA Crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b with bound 2,3-diphosphoglyceric acid and 3- phosphoglyceric acid (see paper)
35% identity, 46% coverage: 6:104/214 of query aligns to 1:104/230 of 3fdzA
Sites not aligning to the query:
Q3JWH7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Burkholderia pseudomallei (strain 1710b) (see paper)
35% identity, 46% coverage: 6:104/214 of query aligns to 1:104/249 of Q3JWH7
Sites not aligning to the query:
3gp5A Crystal structure of phosphoglyceromutase from burkholderia pseudomallei with 3-phosphoglyceric acid and vanadate (see paper)
35% identity, 46% coverage: 6:104/214 of query aligns to 1:104/248 of 3gp5A
Sites not aligning to the query:
P9WIC9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 46% coverage: 9:107/214 of query aligns to 7:110/249 of P9WIC9
P00950 Phosphoglycerate mutase 1; PGAM 1; BPG-dependent PGAM 1; MPGM 1; Phosphoglyceromutase 1; EC 5.4.2.11 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 7 papers)
34% identity, 42% coverage: 6:95/214 of query aligns to 1:95/247 of P00950
Sites not aligning to the query:
1qhfA Yeast phosphoglycerate mutase-3pg complex structure to 1.7 a (see paper)
34% identity, 41% coverage: 8:95/214 of query aligns to 2:94/240 of 1qhfA
Sites not aligning to the query:
7xb9B Phosphoglycerate mutase 1 complexed with a covalent inhibitor
34% identity, 48% coverage: 8:109/214 of query aligns to 3:109/231 of 7xb9B
Sites not aligning to the query:
5pgmE Saccharomyces cerevisiae phosphoglycerate mutase (see paper)
34% identity, 41% coverage: 8:95/214 of query aligns to 2:94/234 of 5pgmE
Sites not aligning to the query:
1bq4A Saccharomyces cerevisiae phosphoglycerate mutase in complex with benzene hexacarboxylate (see paper)
34% identity, 41% coverage: 8:95/214 of query aligns to 2:94/234 of 1bq4A
Sites not aligning to the query:
>WP_041097122.1 NCBI__GCF_000828635.1:WP_041097122.1
MSTARITRFCFVRHGETDWNGEKRIQGQIDIDLNAAGEAQARAVGVGLAKHSFAAAYSSD
LLRAWRTAQIATRGLGLAVSPAPTLRERNFGVLQGITVQEASVQRPEAHRHHQARTPDYN
YESGESLIAFAARVATGLEAMAARHVGQSVLAFTHGGVLDVVYRAAAGRALDVPRDFQLP
NAAFNWLEYDDKGWRLISWADCSHLQRVLDEMLE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory