Comparing WP_041097659.1 NCBI__GCF_000828635.1:WP_041097659.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A9G6 Isocitrate lyase; ICL; Isocitrase; Isocitratase; EC 4.1.3.1 from Escherichia coli (strain K12) (see 3 papers)
71% identity, 100% coverage: 1:435/436 of query aligns to 1:434/434 of P0A9G6
1igwC Crystal structure of the isocitrate lyase from the a219c mutant of escherichia coli (see paper)
70% identity, 95% coverage: 4:418/436 of query aligns to 3:416/416 of 1igwC
1igwA Crystal structure of the isocitrate lyase from the a219c mutant of escherichia coli (see paper)
66% identity, 95% coverage: 4:418/436 of query aligns to 3:396/396 of 1igwA
6lrtA Crystal structure of isocitrate lyase (caur_3889) from chloroflexus aurantiacus in complex with isocitrate and manganese ion
61% identity, 99% coverage: 3:435/436 of query aligns to 2:423/423 of 6lrtA
7cmyC Isocitrate lyase from bacillus cereus atcc 14579 in complex with magnessium ion, glyoxylate, and succinate
60% identity, 99% coverage: 4:435/436 of query aligns to 1:417/417 of 7cmyC
P9WKK7 Isocitrate lyase; ICL; Isocitrase; Isocitratase; EC 4.1.3.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
58% identity, 98% coverage: 11:436/436 of query aligns to 13:428/428 of P9WKK7
7rb1A Isocitrate lyase-1 from mycobacterium tuberculosis covalently modified by 5-descarboxy-5-nitro-d-isocitric acid (see paper)
58% identity, 97% coverage: 11:435/436 of query aligns to 13:427/427 of 7rb1A
6wsiA Intact cis-2,3-epoxysuccinic acid bound to isocitrate lyase-1 from mycobacterium tuberculosis (see paper)
58% identity, 97% coverage: 11:435/436 of query aligns to 13:427/427 of 6wsiA
6vb9A Covalent adduct of cis-2,3-epoxysuccinic acid with isocitrate lyase-1 from mycobacterium tuberculosis (see paper)
58% identity, 97% coverage: 11:435/436 of query aligns to 13:427/427 of 6vb9A
5dqlA Crystal structure of 2-vinyl glyoxylate modified isocitrate lyase from mycobacterium tuberculosis (see paper)
58% identity, 97% coverage: 11:435/436 of query aligns to 13:427/427 of 5dqlA
6xppA Crystal structure of itaconate modified mycobaterium tuberculosis isocitrate lyase (see paper)
58% identity, 97% coverage: 11:435/436 of query aligns to 12:426/426 of 6xppA
6c4aA Crystal structure of 3-nitropropionate modified isocitrate lyase from mycobacterium tuberculosis with pyruvate (see paper)
58% identity, 97% coverage: 11:435/436 of query aligns to 14:428/428 of 6c4aA
1f8iA Crystal structure of isocitrate lyase:nitropropionate:glyoxylate complex from mycobacterium tuberculosis (see paper)
58% identity, 97% coverage: 11:435/436 of query aligns to 13:427/427 of 1f8iA
7rbxC Crystal structure of isocitrate lyase and phosphorylmutase:isocitrate lyase from brucella melitensis biovar abortus 2308 bound to itaconic acid (see paper)
58% identity, 95% coverage: 20:435/436 of query aligns to 14:423/425 of 7rbxC
5e9fD Structural insights of isocitrate lyases from magnaporthe oryzae (see paper)
36% identity, 95% coverage: 3:416/436 of query aligns to 13:452/453 of 5e9fD
7ebeA Crystal structure of isocitrate lyase-1 from candida albicans (see paper)
39% identity, 60% coverage: 3:262/436 of query aligns to 14:276/544 of 7ebeA
Sites not aligning to the query:
6edzA Crystal structure of mycobacterium tuberculosis icl2 in complex with acetyl-coa, form i (see paper)
38% identity, 58% coverage: 3:256/436 of query aligns to 6:264/733 of 6edzA
Sites not aligning to the query:
6edwB Crystal structure of mycobacterium tuberculosis icl2 in the apo form (see paper)
38% identity, 58% coverage: 3:256/436 of query aligns to 6:264/746 of 6edwB
Sites not aligning to the query:
6edwC Crystal structure of mycobacterium tuberculosis icl2 in the apo form (see paper)
38% identity, 58% coverage: 3:256/436 of query aligns to 6:264/724 of 6edwC
Sites not aligning to the query:
P28240 Isocitrate lyase; ICL; Methylisocitrate lyase; MICA; Threo-D(S)-isocitrate glyoxylate-lyase; EC 4.1.3.1; EC 4.1.3.30 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
37% identity, 69% coverage: 6:307/436 of query aligns to 21:324/557 of P28240
>WP_041097659.1 NCBI__GCF_000828635.1:WP_041097659.1
MTDRKAQVAALEKDWKENPRWKGVKRGYSAEDVVRLRGSLPIEYTLAKRGAETLWAKVNG
GAKKGYVNAFGAISAGQAMQQAKAGLEAVYLSGWQVAADGNTSETMYPDQSLYAYDSVPT
MVRRINNTFKRADEIQWSRGINPGDKEYIDFFLPIVADAEAGFGGVLNAFELMKNMIAAG
AAGVHFEDQLAAVKKCGHMGGKVLVPTREAVEKLISARFAADTMGVPTIILARTDAEAAN
LITSDYDANDKPFITGERTQEGFYRVKNGLEQSISRGIAYAPYADLVWCETGVPDIGFAR
EFAQAVLAACPGKLLSYNCSPSFNWKKNLSDSQIASFQEELSALGYKYQFITLAGIHINW
FNTFQFAHAYARGEGMKHYVNMVQEPEFAARDKGYTFVSHQQEVGVGYFDDVTTVIQGGS
SSVKALTGSTEEEQFH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory