Comparing WP_041097708.1 NCBI__GCF_000828635.1:WP_041097708.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
47% identity, 99% coverage: 1:388/390 of query aligns to 1:376/376 of O66442
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
47% identity, 99% coverage: 3:388/390 of query aligns to 2:375/375 of 2eh6A
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
45% identity, 98% coverage: 4:384/390 of query aligns to 10:389/390 of 8ht4B
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
44% identity, 98% coverage: 4:384/390 of query aligns to 11:383/390 of A0QYS9
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
44% identity, 95% coverage: 4:372/390 of query aligns to 69:441/457 of Q9M8M7
Sites not aligning to the query:
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
43% identity, 95% coverage: 3:372/390 of query aligns to 10:378/393 of 2ordA
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
43% identity, 95% coverage: 3:372/390 of query aligns to 2:370/385 of Q9X2A5
P9WPZ7 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
44% identity, 99% coverage: 4:390/390 of query aligns to 19:399/400 of P9WPZ7
Sites not aligning to the query:
7nncC Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal-5'-phosphate and 6-methoxyquinoline-3-carboxylic acid
44% identity, 98% coverage: 4:386/390 of query aligns to 13:389/391 of 7nncC
7nn4A Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal 5'-phosphate and 3-hydroxy-2-naphthoic acid.
44% identity, 98% coverage: 4:386/390 of query aligns to 13:389/391 of 7nn4A
3nx3A Crystal structure of acetylornithine aminotransferase (argd) from campylobacter jejuni
38% identity, 99% coverage: 3:387/390 of query aligns to 3:388/388 of 3nx3A
4addA Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
40% identity, 97% coverage: 4:380/390 of query aligns to 12:388/400 of 4addA
4adbB Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
40% identity, 97% coverage: 4:380/390 of query aligns to 12:388/401 of 4adbB
4jevB N-acetylornithine aminotransferase from s. Typhimurium complexed with gabaculine
41% identity, 91% coverage: 18:372/390 of query aligns to 26:383/402 of 4jevB
P40732 Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
40% identity, 91% coverage: 18:372/390 of query aligns to 31:388/405 of P40732
5e3kA Crystal structure of the ornithine aminotransferase from toxoplasma gondii me49 in a complex with (s)-4-amino-5-fluoropentanoic acid
36% identity, 99% coverage: 3:389/390 of query aligns to 27:417/422 of 5e3kA
5e5iA Structure of the ornithine aminotransferase from toxoplasma gondii in complex with inactivator
36% identity, 99% coverage: 3:389/390 of query aligns to 26:416/421 of 5e5iA
5dj9A Crystal structure of the ornithine aminotransferase from toxoplasma gondii me49 in a complex with gabaculine
36% identity, 99% coverage: 3:389/390 of query aligns to 26:416/421 of 5dj9A
5e3kB Crystal structure of the ornithine aminotransferase from toxoplasma gondii me49 in a complex with (s)-4-amino-5-fluoropentanoic acid
36% identity, 99% coverage: 3:389/390 of query aligns to 28:418/424 of 5e3kB
5eqcA Structure of the ornithine aminotransferase from toxoplasma gondii crystallized in presence of oxidized glutathione reveals partial occupancy of plp at the protein active site
36% identity, 99% coverage: 3:389/390 of query aligns to 29:419/426 of 5eqcA
>WP_041097708.1 NCBI__GCF_000828635.1:WP_041097708.1
MPHLMNTYGRLPVAFTHGQGCRLFDEQGKSYLDALAGIAVNTLGHNHPRLVKALSNQVAR
LIHTSNLYRISEAEAASDRLAALSGMDEVFFCNSGCEANEAAIKLARMYGHQQGVEQPAI
IVMEHAFHGRTLATLSATGNRKVQAGFEPLVSGFVRVPFDDLAAIEQLAERNPNVVAVLF
EPIQGEGGINLAHNDFMRALRKICDRKNWLFMVDEVQCGIGRTGVWFAHQHAGILPDVMT
LAKGLGSGVPIGACLAAGRAAGVFKPGNHGSTFGGNPLACVAALTTLDVVEADGLMARAT
MLGETIRGGLRSGLAGTSGFVEVRGDGLMIGIELDRPCGDLVRRGLESGLLINVTADKVV
RLLPALVMSDAEGAELVTGLVALIKEFLGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory