SitesBLAST
Comparing WP_041098312.1 NCBI__GCF_000828635.1:WP_041098312.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q5F8J4 NAD(+)-dependent homoserine dehydrogenase; NAD(+)-dependent HSD; NgHSD; EC 1.1.1.3 from Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) (see paper)
62% identity, 100% coverage: 1:435/436 of query aligns to 1:433/435 of Q5F8J4
- L45 (≠ K45) mutation to R: Shows a marked increase in the catalytic efficiency with NADP(+).
- LS 45:46 (≠ KN 45:46) mutation to RD: Does not impair the catalytic activity with NAD(+). Slightly increases the activity, but slightly decreases the affinity for NADP(+).; mutation to RR: Causes a shift in coenzyme preference from NAD(+) to NADP(+) by a factor of 974. Shows a slight decrease in the catalytic efficiency with NAD(+) and a 4.5-fold increase in catalytic efficiency with NADP(+).
6dzsA Mycobacterial homoserine dehydrogenase thra in complex with NADP
38% identity, 99% coverage: 2:433/436 of query aligns to 3:429/431 of 6dzsA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G10), L12 (≠ I11), G13 (= G12), N14 (≠ T13), V15 (= V14), V45 (≠ A50), R46 (= R51), R47 (≠ Q52), R52 (= R57), I63 (≠ A64), L78 (= L79), M79 (≠ I80), P84 (≠ I85), A102 (= A103), K104 (= K105), G306 (= G302), T310 (= T306)
4pg7A Crystal structure of s. Aureus homoserine dehydrogenase at ph7.5 (see paper)
42% identity, 73% coverage: 1:317/436 of query aligns to 2:306/402 of 4pg7A
Sites not aligning to the query:
7f4cA The crystal structure of the immature holo-enzyme of homoserine dehydrogenase complexed with NADP and 1,4-butandiol from the hyperthermophilic archaeon sulfurisphaera tokodaii. (see paper)
41% identity, 53% coverage: 89:319/436 of query aligns to 86:297/300 of 7f4cA
Sites not aligning to the query:
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 6, 7, 8, 9, 10, 11, 37, 38, 39, 72, 73, 74
5x9dA Crystal structure of homoserine dehydrogenase in complex with l- cysteine and NAD (see paper)
40% identity, 53% coverage: 89:319/436 of query aligns to 86:299/302 of 5x9dA
- active site: D196 (= D201), K200 (= K205)
- binding (2R)-3-[[(4S)-3-aminocarbonyl-1-[(2R,3R,4S,5R)-5-[[[[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxymethyl]-3,4-bis(oxidanyl)oxolan-2-yl]-4H-pyridin-4-yl]sulfanyl]-2-azanyl-propanoic acid: T100 (≠ A103), N101 (= N104), K102 (= K105), G127 (≠ A130), S131 (≠ G134), N155 (= N159), G156 (= G160), T157 (= T161), Y183 (= Y188), A184 (= A189), E185 (= E190), D191 (= D196), D196 (= D201), K200 (= K205), A281 (= A301), G282 (= G302), A286 (≠ T306)
Sites not aligning to the query:
- binding (2R)-3-[[(4S)-3-aminocarbonyl-1-[(2R,3R,4S,5R)-5-[[[[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxymethyl]-3,4-bis(oxidanyl)oxolan-2-yl]-4H-pyridin-4-yl]sulfanyl]-2-azanyl-propanoic acid: 6, 7, 8, 9, 10, 11, 37, 38, 72, 73, 74, 82
6a0tB Homoserine dehydrogenase k99a mutant from thermus thermophilus hb8 complexed with hse and NADP+ (see paper)
35% identity, 79% coverage: 1:343/436 of query aligns to 1:327/332 of 6a0tB
- active site: D191 (= D201), K195 (= K205)
- binding l-homoserine: N150 (= N159), G151 (= G160), T152 (= T161), Y178 (= Y188), E180 (= E190), D186 (= D196), K195 (= K205)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G10), G11 (≠ I11), G12 (= G12), T13 (= T13), V14 (= V14), L42 (≠ A43), V43 (≠ D44), R44 (≠ K45), D45 (≠ N46), K48 (≠ L49), R50 (= R51), A73 (≠ L79), M74 (≠ I80), G75 (= G81), A97 (= A103), N98 (= N104), G177 (= G187), E180 (= E190), A289 (= A301), G290 (= G302), T294 (= T306)
6a0sA Homoserine dehydrogenase from thermus thermophilus hb8 complexed with hse and NADPH (see paper)
35% identity, 79% coverage: 1:343/436 of query aligns to 1:327/331 of 6a0sA
- active site: D191 (= D201), K195 (= K205)
- binding l-homoserine: K99 (= K105), N150 (= N159), G151 (= G160), T152 (= T161), Y178 (= Y188), E180 (= E190), D186 (= D196), K195 (= K205)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (≠ I11), G12 (= G12), T13 (= T13), V14 (= V14), L42 (≠ A43), V43 (≠ D44), R44 (≠ K45), D45 (≠ N46), K48 (≠ L49), R50 (= R51), A73 (≠ L79), M74 (≠ I80), A97 (= A103), K99 (= K105), G177 (= G187), E180 (= E190), A289 (= A301), G290 (= G302), T294 (= T306)
2ejwA Homoserine dehydrogenase from thermus thermophilus hb8
35% identity, 79% coverage: 1:343/436 of query aligns to 1:327/331 of 2ejwA
4xb1A Hyperthermophilic archaeal homoserine dehydrogenase in complex with NADPH (see paper)
28% identity, 72% coverage: 4:318/436 of query aligns to 3:312/319 of 4xb1A
- active site: D211 (= D201), K215 (= K205)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F8 (≠ L9), F10 (≠ I11), G11 (= G12), T12 (= T13), V13 (= V14), D39 (≠ R31), R40 (= R32), K57 (≠ T54), V91 (≠ I80), S92 (≠ G81), S93 (≠ G82), S114 (≠ A103), K116 (= K105), S141 (≠ A130), G295 (≠ A301), T300 (= T306)
4xb2A Hyperthermophilic archaeal homoserine dehydrogenase mutant in complex with NADPH (see paper)
28% identity, 72% coverage: 4:318/436 of query aligns to 3:312/319 of 4xb2A
- active site: D211 (= D201), K215 (= K205)
- binding l-homoserine: A171 (≠ G160), S172 (≠ T161), D206 (= D196), K215 (= K205)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F8 (≠ L9), F10 (≠ I11), G11 (= G12), T12 (= T13), V13 (= V14), R40 (= R32), V91 (≠ I80), S92 (≠ G81), S93 (≠ G82), S114 (≠ A103), N115 (= N104), K116 (= K105), S141 (≠ A130), G295 (≠ A301), T300 (= T306)
3ingA Crystal structure of homoserine dehydrogenase (np_394635.1) from thermoplasma acidophilum at 1.95 a resolution
30% identity, 53% coverage: 2:230/436 of query aligns to 1:238/319 of 3ingA
- active site: D209 (= D201), K213 (= K205)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G10), T10 (≠ I11), G11 (= G12), N12 (≠ T13), V13 (= V14), D38 (= D44), S39 (vs. gap), K57 (vs. gap), C85 (≠ L79), T86 (≠ I80), P87 (vs. gap), A112 (= A103), N113 (= N104), K114 (= K105), A139 (= A130), E198 (= E190), S199 (≠ A191)
Sites not aligning to the query:
3jsaA Homoserine dehydrogenase from thermoplasma volcanium complexed with NAD
29% identity, 52% coverage: 1:228/436 of query aligns to 1:239/321 of 3jsaA
- active site: D212 (= D201), K216 (= K205)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), L11 (≠ I11), G12 (= G12), N13 (≠ T13), V14 (= V14), D42 (= D44), S43 (vs. gap), A90 (≠ L79), T91 (≠ I80), P92 (≠ G81), A117 (= A103), N118 (= N104), A144 (= A130)
Sites not aligning to the query:
O94671 Probable homoserine dehydrogenase; HDH; EC 1.1.1.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 52% coverage: 4:231/436 of query aligns to 8:249/376 of O94671
- S201 (= S175) modified: Phosphoserine
P31116 Homoserine dehydrogenase; HDH; EC 1.1.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
29% identity, 48% coverage: 2:209/436 of query aligns to 4:227/359 of P31116
- 11:18 (vs. 9:16, 50% identical) binding
- T93 (≠ I80) binding
- K117 (= K105) binding
- E208 (= E190) binding ; mutation to D: Increases KM for aspartate-semialdehyde 48-fold and reduces kcat by 50%.; mutation E->L,Q: Loss of activity.
- D219 (= D201) mutation to L: Reduces kcat 150-fold.
- K223 (= K205) mutation to V: Loss of activity.
1tveA Homoserine dehydrogenase in complex with 4-(4-hydroxy-3- isopropylphenylthio)-2-isopropylphenol (see paper)
29% identity, 48% coverage: 2:209/436 of query aligns to 3:226/358 of 1tveA
1q7gA Homoserine dehydrogenase in complex with suicide inhibitor complex NAD-5-hydroxy-4-oxonorvaline (see paper)
29% identity, 48% coverage: 2:209/436 of query aligns to 3:226/358 of 1q7gA
- active site: D218 (= D201), K222 (= K205)
- binding nicotinamide-adenine-dinucleotide-5-hydroxy-4-oxonorvaline: G13 (= G12), V14 (≠ T13), V15 (= V14), E39 (≠ R24), N91 (≠ L79), T92 (≠ I80), S93 (≠ G81), I97 (= I85), P114 (≠ A103), K116 (= K105), A143 (= A130), S173 (≠ N159), K222 (= K205)
Sites not aligning to the query:
1ebuD Homoserine dehydrogenase complex with NAD analogue and l-homoserine (see paper)
29% identity, 48% coverage: 2:209/436 of query aligns to 3:226/358 of 1ebuD
- active site: D218 (= D201), K222 (= K205)
- binding 3-aminomethyl-pyridinium-adenine-dinucleotide: G11 (= G10), A12 (≠ I11), G13 (= G12), V14 (≠ T13), V15 (= V14), E39 (≠ R24), A40 (≠ N25), N91 (≠ L79), S93 (≠ G81), K116 (= K105)
Sites not aligning to the query:
1ebfA Homoserine dehydrogenase from s. Cerevisiae complex with NAD+ (see paper)
29% identity, 48% coverage: 2:209/436 of query aligns to 3:226/358 of 1ebfA
- active site: D218 (= D201), K222 (= K205)
- binding nicotinamide-adenine-dinucleotide: I10 (≠ L9), A12 (≠ I11), G13 (= G12), V14 (≠ T13), V15 (= V14), E39 (≠ R24), A40 (≠ N25), T92 (≠ I80), S93 (≠ G81), P114 (≠ A103)
O81852 Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic; AK-HD 2; AK-HSDH 2; Beta-aspartyl phosphate homoserine 2; EC 2.7.2.4; EC 1.1.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 43% coverage: 128:315/436 of query aligns to 699:906/916 of O81852
Sites not aligning to the query:
- 441 I→A: Loss of threonine sensitivity for the aspartokinase activity and decreased inhibition of homoserine dehydrogenase activity by threonine.
- 443 Q→A: Loss of threonine sensitivity for the aspartokinase activity and decreased inhibition of homoserine dehydrogenase activity by threonine.
- 522 I→A: No effect on the inhibition of aspartokinase activity by threonine, but decreased inhibition of homoserine dehydrogenase activity by threonine.
- 524 Q→A: No effect on the inhibition of aspartokinase activity by threonine, but decreased inhibition of homoserine dehydrogenase activity by threonine.
3uplA Crystal structure of the brucella abortus enzyme catalyzing the first committed step of the methylerythritol 4-phosphate pathway. (see paper)
31% identity, 30% coverage: 2:130/436 of query aligns to 21:164/437 of 3uplA
Sites not aligning to the query:
Query Sequence
>WP_041098312.1 NCBI__GCF_000828635.1:WP_041098312.1
MKPINVGLLGIGTVGGGTFNVLARNEAEITRRAGRPIRITKVADKNLELARQVTAGRAEV
TDDAFSVVSDPEIDIVIELIGGYGIARELVLKAIANGKHVVTANKALLAVHGNEIFAAAH
EKGVMVGFEAAVAGGIPIIKALREGLSANRIQWIAGIINGTTNFILSEMRDKGLSFDTVL
KEAQRLGYAEADPTFDIEGIDAAHKITILSALAFGIRMQFDKAHVEGISKLDADDIKYAE
QLGYRIKLLGITRRRPEGVELRVHPTLIPAKRLIANVEGAMNAVLVQGDAVGATLYYGKG
AGAEPTASAVIADLVDVTRMHTADPEHRVPHLAFQPGAVEDTPILPLSEVETSYYLRLRV
EDKPGVLADITRILADQQISIDAMIQREPAEGESQTDIIMLTHITREKNVDAAIARIEAL
PVVKKQVIRLRMEELG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory