Comparing WP_041098607.1 NCBI__GCF_000828635.1:WP_041098607.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6agmA Molecular basis for feedback inhibition of tyrosine-regulated 3-deoxy- d-arabino-heptulosonate-7-phosphate synthase from escherichia coli (see paper)
51% identity, 97% coverage: 6:355/360 of query aligns to 5:331/334 of 6agmA
1gg1A Crystal structure analysis of dahp synthase in complex with mn2+ and 2-phosphoglycolate (see paper)
48% identity, 96% coverage: 6:351/360 of query aligns to 1:336/339 of 1gg1A
1kflA Crystal structure of phenylalanine-regulated 3-deoxy-d-arabino- heptulosonate-7-phosphate synthase (dahp synthase) from e.Coli complexed with mn2+, pep, and phe (see paper)
48% identity, 97% coverage: 3:351/360 of query aligns to 4:346/350 of 1kflA
P0AB91 Phospho-2-dehydro-3-deoxyheptonate aldolase, Phe-sensitive; 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase; DAHP synthase; Phospho-2-keto-3-deoxyheptonate aldolase; EC 2.5.1.54 from Escherichia coli (strain K12) (see paper)
48% identity, 97% coverage: 3:351/360 of query aligns to 4:346/350 of P0AB91
5cksB Dahp (3-deoxy-d-arabinoheptulosonate-7-phosphate) synthase in complex with dahp oxime. (see paper)
48% identity, 96% coverage: 5:351/360 of query aligns to 1:341/345 of 5cksB
1qr7A Crystal structure of phenylalanine-regulated 3-deoxy-d-arabino- heptulosonate-7-phosphate synthase from escherichia coli complexed with pb2+ and pep (see paper)
48% identity, 96% coverage: 7:351/360 of query aligns to 1:334/338 of 1qr7A
8e0sD Dahp (3-deoxy-d-arabinoheptulosonate-7-phosphate) synthase complexed with dahp oxime in unbound:(bound)2:unbound conformations (see paper)
48% identity, 96% coverage: 6:351/360 of query aligns to 1:340/343 of 8e0sD
7rudB Dahp synthase complex with trifluoropyruvate oxime (see paper)
48% identity, 96% coverage: 6:351/360 of query aligns to 1:340/343 of 7rudB
7rueA Dahp synthase complexed with trifluoropyruvate semicarbazone (see paper)
48% identity, 97% coverage: 4:351/360 of query aligns to 1:336/339 of 7rueA
5cksA Dahp (3-deoxy-d-arabinoheptulosonate-7-phosphate) synthase in complex with dahp oxime. (see paper)
48% identity, 97% coverage: 4:351/360 of query aligns to 1:335/339 of 5cksA
1ofoA Crystal structure of the tyrosine regulated 3-deoxy-d-arabino- heptulosonate-7-phosphate synthase from saccharomyces cerevisiae in complex with 2-phosphoglycolate (see paper)
48% identity, 96% coverage: 6:351/360 of query aligns to 1:337/344 of 1ofoA
8e0sA Dahp (3-deoxy-d-arabinoheptulosonate-7-phosphate) synthase complexed with dahp oxime in unbound:(bound)2:unbound conformations (see paper)
48% identity, 96% coverage: 6:351/360 of query aligns to 1:332/336 of 8e0sA
1of6A Crystal structure of the tyrosine-regulated 3-deoxy-d-arabino- heptulosonate-7-phosphate synthase from saccharomyces cerevisiae complexed with tyrosine and manganese
48% identity, 96% coverage: 5:351/360 of query aligns to 4:344/350 of 1of6A
1ofrC Crystal structure of the tyrosine-regulated 3-deoxy-d-arabino- heptulosonate-7-phosphate synthase from saccharomyces cerevisiae complexed with phenylalanine and manganese (see paper)
47% identity, 96% coverage: 5:351/360 of query aligns to 2:341/348 of 1ofrC
1of8A Double complex of the tyrosine sensitive dahp synthase from s. Cerevisiae with co2+, pep and the e4p analogoue g3p (see paper)
47% identity, 96% coverage: 7:351/360 of query aligns to 1:333/339 of 1of8A
1hfbA Crystal structure of the tyrosine-regulated 3-deoxy-d-arabino- heptulosonate-7-phosphate synthase from saccharomyces cerevisiae complexed with phosphoenolpyruvate (see paper)
47% identity, 96% coverage: 7:351/360 of query aligns to 1:332/339 of 1hfbA
7reuB Crystal structure of aro4p, 3-deoxy-d-arabino-heptulosonate-7- phosphate (dahp) synthase from candida auris, l-tyr complex
44% identity, 95% coverage: 2:343/360 of query aligns to 1:343/358 of 7reuB
4hsoA Crystal structure of s213g variant dah7ps from neisseria meningitidis (see paper)
47% identity, 94% coverage: 4:343/360 of query aligns to 2:331/345 of 4hsoA
5dcbC Neisseria meningitidis 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase regulated and complexed with pep
47% identity, 94% coverage: 4:343/360 of query aligns to 6:335/348 of 5dcbC
5dcdA Neisseria meningitidis 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase regulated (tyrosine)
47% identity, 94% coverage: 4:343/360 of query aligns to 4:333/346 of 5dcdA
>WP_041098607.1 NCBI__GCF_000828635.1:WP_041098607.1
MQQTENLNIEAFEPMPTPEEIHARVPLSDAAAESVLAGRRTLERILDGTDPRVFVVVGPC
SIHDPVAGLDYARRLKKLADEVAGTMLLVMRVYFEKPRTATGWKGYINDPRMDDSFHIEE
GMQKAREFLLAVNEIGLPAATEALDPIGPQYLGDLIAWVAIGARTSESQTHREMSSGLSA
PVGFKNGTDGSLDAAVNAIISASSQHSFLGINMQGRSSVVRTAGNRYGHLVLRGGGGRPN
YDTVSVALAEAALDKAKLPHNIVVDCSHANSYKKPELQPLVMHDCINQIADQRKAGHRSI
VGLMIESFIEAGNQPIPADLSQLKYGCSVTDACVDWATTEKMLREADAALRGVITNPNPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory