SitesBLAST
Comparing WP_041098945.1 NCBI__GCF_000828635.1:WP_041098945.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P87228 Putative D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 92% coverage: 10:375/398 of query aligns to 57:443/466 of P87228
- S87 (≠ K38) modified: Phosphoserine
- S258 (≠ V212) modified: Phosphoserine
2p9eA Crystal structure of g336v mutant of e.Coli phosphoglycerate dehydrogenase (see paper)
32% identity, 86% coverage: 52:394/398 of query aligns to 66:405/406 of 2p9eA
- active site: N104 (= N90), R236 (= R238), D260 (= D262), E265 (≠ A266), H288 (= H279)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G156 (= G153), H157 (≠ K154), I158 (= I155), Y176 (= Y173), D177 (= D174), I178 (≠ P175), H206 (= H208), V207 (= V209), P208 (= P210), S212 (≠ A214), A234 (≠ F236), S235 (= S237), R236 (= R238), H288 (= H279), G290 (= G281)
P0A9T0 D-3-phosphoglycerate dehydrogenase; PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Escherichia coli (strain K12) (see 2 papers)
32% identity, 86% coverage: 52:394/398 of query aligns to 70:409/410 of P0A9T0
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1ybaA The active form of phosphoglycerate dehydrogenase (see paper)
32% identity, 86% coverage: 52:394/398 of query aligns to 66:405/406 of 1ybaA
- active site: N104 (= N90), R236 (= R238), D260 (= D262), E265 (≠ A266), H288 (= H279)
- binding 2-oxoglutaric acid: C79 (≠ G65), I80 (≠ S66)
- binding nicotinamide-adenine-dinucleotide: I80 (≠ S66), F102 (≠ G88), V108 (= V94), G154 (= G151), G156 (= G153), H157 (≠ K154), I158 (= I155), Y176 (= Y173), D177 (= D174), I178 (≠ P175), K181 (≠ S184), H206 (= H208), V207 (= V209), P208 (= P210), A234 (≠ F236), S235 (= S237), R236 (= R238), H288 (= H279), G290 (= G281)
- binding phosphate ion: G81 (= G67), N83 (= N69)
Sites not aligning to the query:
1psdA The allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase (see paper)
32% identity, 86% coverage: 52:394/398 of query aligns to 64:403/404 of 1psdA
- active site: N102 (= N90), R234 (= R238), D258 (= D262), E263 (≠ A266), H286 (= H279)
- binding nicotinamide-adenine-dinucleotide: N102 (= N90), H155 (≠ K154), I156 (= I155), D175 (= D174), I176 (≠ P175), K179 (≠ S184), H204 (= H208), V205 (= V209), P206 (= P210), A232 (≠ F236), S233 (= S237), R234 (= R238), H286 (= H279)
- binding serine: H338 (≠ N331), N340 (= N333), R341 (≠ V334), V344 (≠ M337)
1sc6D Crystal structure of w139g d-3-phosphoglycerate dehydrogenase complexed with NAD+ (see paper)
31% identity, 85% coverage: 55:394/398 of query aligns to 67:383/384 of 1sc6D
- active site: N102 (= N90), R228 (= R238), D252 (= D262)
- binding nicotinamide-adenine-dinucleotide: P99 (= P87), F100 (≠ G88), N102 (= N90), T103 (≠ A91), G146 (= G151), G148 (= G153), H149 (≠ K154), I150 (= I155), Y168 (= Y173), D169 (= D174), I170 (≠ P175), H198 (= H208), V199 (= V209), P200 (= P210), S204 (≠ A214), T205 (= T215), S227 (= S237)
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
31% identity, 69% coverage: 40:313/398 of query aligns to 49:317/533 of O43175
- T78 (≠ S66) binding
- R135 (≠ K134) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ KI 154:155) binding
- D175 (= D174) binding
- T207 (≠ V209) binding
- CAR 234:236 (≠ FSR 236:238) binding
- D260 (≠ G257) binding
- V261 (≠ C258) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (= HLGA 279:282) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
7dkmA Phgdh covalently linked to oridonin (see paper)
31% identity, 66% coverage: 40:303/398 of query aligns to 45:303/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ S66), A102 (≠ V94), G148 (= G151), R151 (≠ K154), I152 (= I155), Y170 (= Y173), D171 (= D174), P172 (= P175), I173 (≠ E176), H202 (= H208), T203 (≠ V209), P204 (= P210), T209 (= T215), C230 (≠ F236), A231 (≠ S237), R232 (= R238), H279 (= H279), G281 (= G281)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: E293 (≠ I293)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
32% identity, 66% coverage: 40:303/398 of query aligns to 45:303/305 of 6plfA
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
32% identity, 66% coverage: 40:303/398 of query aligns to 44:302/303 of 6plgA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
31% identity, 66% coverage: 40:301/398 of query aligns to 44:300/301 of 6rj5A
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
31% identity, 66% coverage: 40:303/398 of query aligns to 44:302/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ V150), G147 (= G151), L148 (= L152), G149 (= G153), R150 (≠ K154), I151 (= I155), G152 (= G156), D170 (= D174), H201 (= H208), T202 (≠ V209), P203 (= P210)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
31% identity, 66% coverage: 40:303/398 of query aligns to 44:302/302 of 6rihA
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
32% identity, 66% coverage: 40:301/398 of query aligns to 43:299/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (= N90), A100 (≠ V94), R149 (≠ K154), I150 (= I155), Y168 (= Y173), D169 (= D174), P170 (= P175), I171 (≠ E176), H200 (= H208), T201 (≠ V209), P202 (= P210), T207 (= T215), C228 (≠ F236), A229 (≠ S237), R230 (= R238), H277 (= H279), G279 (= G281)
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
31% identity, 66% coverage: 40:303/398 of query aligns to 41:299/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G153), I148 (= I155), Y166 (= Y173), D167 (= D174), P168 (= P175), I169 (≠ E176), I170 (= I177), H198 (= H208), T199 (≠ V209), L208 (≠ M218), R228 (= R238)
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
32% identity, 66% coverage: 40:301/398 of query aligns to 39:291/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ K154), Y160 (= Y173), D161 (= D174), P162 (= P175), I164 (= I177), L179 (= L195), T193 (≠ V209), P194 (= P210), S198 (≠ A214), L202 (≠ M218)
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
32% identity, 65% coverage: 40:298/398 of query aligns to 43:296/297 of 6rj3A
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
34% identity, 71% coverage: 36:316/398 of query aligns to 40:315/525 of 3ddnB
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
34% identity, 71% coverage: 36:316/398 of query aligns to 39:314/526 of 3dc2A
Sites not aligning to the query:
7cvpA The crystal structure of human phgdh from biortus.
31% identity, 65% coverage: 43:301/398 of query aligns to 13:254/254 of 7cvpA
- binding nicotinamide-adenine-dinucleotide: G101 (= G151), G103 (= G153), R104 (≠ K154), I105 (= I155), Y123 (= Y173), D124 (= D174), P125 (= P175), I126 (≠ E176), H155 (= H208), T156 (≠ V209), P157 (= P210), T162 (= T215), C183 (≠ F236), A184 (≠ S237), R185 (= R238), H232 (= H279), G234 (= G281)
Query Sequence
>WP_041098945.1 NCBI__GCF_000828635.1:WP_041098945.1
MVDQALTQFQVLVLNNVSQNGLKRMPAERFACAKDVAKPDAILLRSADLHSVEIAKSVLA
IGRAGSGTNNIPVAEMSKRGVPVFNAPGANANAVKELVLAGMLLAARNIGGAMKFVAALD
PSDAEMEKKVEGGKKTYAGYEISGHTLGVVGLGKIGCLVADAAIKLGMNVIGYDPEITVD
AAWSLPSQVKKANSLGDVLRHSNFVTLHVPLVDATRKMINAESIEQMKHGAVLLNFSREG
VADEAAVLAALDARRLGCYVCDFPSARVNSHPHVIALPHLGASTREAEENCAIMVADQVR
DYLLDGNIVNSVNFPGVAMPRESAFRIAIANANVPNMVGQISTAMADARLNIHNMMNKSK
KDVAYTLVDVDSKVPKKVIDQIAKIEGVLSVRYLPAES
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory