SitesBLAST
Comparing WP_041100790.1 NCBI__GCF_000828635.1:WP_041100790.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
46% identity, 97% coverage: 8:306/307 of query aligns to 16:307/308 of P27305
- E55 (= E47) binding
- Y182 (= Y181) binding
- R200 (= R199) binding
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
48% identity, 93% coverage: 8:293/307 of query aligns to 4:280/290 of 4a91A
- active site: S11 (= S15), K229 (= K240)
- binding glutamic acid: R7 (= R11), A9 (= A13), S11 (= S15), E43 (= E47), Y170 (= Y181), R188 (= R199), L192 (= L203)
- binding zinc ion: C99 (= C103), C101 (= C105), Y113 (= Y123), C117 (= C127)
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
36% identity, 78% coverage: 9:247/307 of query aligns to 4:247/468 of 8i9iA
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
36% identity, 78% coverage: 9:247/307 of query aligns to 4:247/471 of P04805
- C98 (= C103) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (= C105) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (= C127) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (≠ A129) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (≠ L131) mutation to Q: No change in activity or in zinc content.
- H131 (≠ A133) mutation to Q: No change in activity or in zinc content.
- H132 (≠ G134) mutation to Q: No change in activity or in zinc content.
- C138 (≠ W140) mutation to S: No change in activity or in zinc content.
- S239 (= S239) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
37% identity, 85% coverage: 9:268/307 of query aligns to 3:282/484 of 2cfoA
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
37% identity, 85% coverage: 9:268/307 of query aligns to 4:283/485 of Q8DLI5
- R6 (= R11) binding
- Y192 (= Y181) binding
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
39% identity, 78% coverage: 9:247/307 of query aligns to 4:232/380 of 4g6zA
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
32% identity, 84% coverage: 9:266/307 of query aligns to 104:365/564 of 3al0C
- active site: S110 (= S15), K335 (= K240)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R11), A108 (= A13), P109 (= P14), G118 (= G23), T122 (≠ A27), E142 (= E47), Y276 (= Y181), R294 (= R199), G295 (= G200), D297 (= D202), H298 (≠ L203), L324 (≠ V229), I325 (≠ V230), L333 (= L238)
- binding : T144 (≠ V49), D145 (= D50), R148 (= R53), Y208 (≠ C105), P213 (≠ L110), K252 (≠ Q156), M255 (≠ I159), I266 (= I171), K269 (≠ R174), S270 (≠ A175), Y276 (= Y181), D297 (= D202), H298 (≠ L203), L299 (= L204), S300 (≠ A205), N301 (≠ S206), K304 (≠ R209), R330 (≠ G235), P332 (≠ K237), G363 (= G264), W364 (≠ Q265), R365 (= R266)
Sites not aligning to the query:
- binding : 370, 387, 389, 391, 392, 397, 400, 407, 446, 447, 453, 457, 509, 520, 524, 527, 535, 536, 538, 539
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
33% identity, 76% coverage: 9:241/307 of query aligns to 3:254/485 of 4griB
- active site: S9 (= S15), K253 (= K240)
- binding glutamic acid: R5 (= R11), A7 (= A13), S9 (= S15), E41 (= E47), Y194 (= Y181), R212 (= R199), W216 (≠ L203)
- binding zinc ion: C105 (= C103), C107 (= C105), Y128 (≠ T126), C132 (≠ G130)
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
33% identity, 86% coverage: 1:265/307 of query aligns to 1:280/488 of 8vc5A
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
29% identity, 76% coverage: 9:241/307 of query aligns to 4:262/502 of 6brlA
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
33% identity, 78% coverage: 11:248/307 of query aligns to 5:254/468 of 2cv2A
- active site: K246 (= K240)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R11), A7 (= A13), S9 (= S15), G17 (= G23), I21 (≠ A27), E41 (= E47), Y187 (= Y181), R205 (= R199), A206 (≠ G200), E208 (≠ D202), W209 (≠ L203), L235 (≠ V229), L236 (≠ V230)
- binding : S9 (= S15), T43 (≠ V49), D44 (= D50), R47 (= R53), V145 (vs. gap), R163 (≠ Q156), Y168 (≠ S161), E172 (= E166), V177 (≠ I171), K180 (≠ R174), S181 (≠ A175), Y187 (= Y181), E207 (≠ A201), E208 (≠ D202), W209 (≠ L203), V211 (≠ A205), R237 (≠ V231), K241 (≠ G235)
Sites not aligning to the query:
- binding : 272, 273, 274, 282, 299, 303, 304, 309, 312, 319, 357, 358, 417, 432, 435, 442, 443, 444, 446, 447, 448
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
33% identity, 78% coverage: 11:248/307 of query aligns to 5:254/468 of 2cv1A
- active site: K246 (= K240)
- binding adenosine-5'-triphosphate: P8 (= P14), S9 (= S15), G17 (= G23), T18 (≠ S24), I21 (≠ A27), R47 (= R53), A206 (≠ G200), W209 (≠ L203), L235 (≠ V229), L236 (≠ V230)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R11), A7 (= A13), E41 (= E47), Y187 (= Y181), R205 (= R199), W209 (≠ L203)
- binding : S9 (= S15), E41 (= E47), T43 (≠ V49), D44 (= D50), R47 (= R53), V145 (vs. gap), R163 (≠ Q156), V166 (≠ I159), E172 (= E166), V177 (≠ I171), K180 (≠ R174), S181 (≠ A175), Y187 (= Y181), E207 (≠ A201), E208 (≠ D202), W209 (≠ L203), V211 (≠ A205), R237 (≠ V231), K241 (≠ G235), K243 (= K237)
Sites not aligning to the query:
- binding : 273, 274, 276, 282, 299, 303, 304, 309, 312, 319, 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l- glutamate (see paper)
33% identity, 78% coverage: 11:248/307 of query aligns to 5:254/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
33% identity, 78% coverage: 11:248/307 of query aligns to 5:254/468 of 1n78A
- active site: K246 (= K240)
- binding glutamol-amp: R5 (= R11), A7 (= A13), P8 (= P14), S9 (= S15), G17 (= G23), T18 (≠ S24), I21 (≠ A27), E41 (= E47), Y187 (= Y181), N191 (≠ V185), R205 (= R199), A206 (≠ G200), E208 (≠ D202), W209 (≠ L203), L235 (≠ V229), L236 (≠ V230)
- binding : S9 (= S15), T43 (≠ V49), D44 (= D50), R47 (= R53), V145 (vs. gap), R163 (≠ Q156), V166 (≠ I159), Y168 (≠ S161), E172 (= E166), V177 (≠ I171), K180 (≠ R174), S181 (≠ A175), Y187 (= Y181), E207 (≠ A201), E208 (≠ D202), W209 (≠ L203), L210 (= L204), V211 (≠ A205), R237 (≠ V231), K241 (≠ G235)
Sites not aligning to the query:
- binding : 273, 274, 282, 297, 303, 304, 309, 312, 319, 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
33% identity, 78% coverage: 11:248/307 of query aligns to 5:254/468 of 1j09A
- active site: K246 (= K240)
- binding adenosine-5'-triphosphate: H15 (= H21), E208 (≠ D202), L235 (≠ V229), L236 (≠ V230), K243 (= K237), I244 (≠ L238), S245 (= S239), K246 (= K240), R247 (≠ Q241)
- binding glutamic acid: R5 (= R11), A7 (= A13), S9 (= S15), E41 (= E47), Y187 (= Y181), N191 (≠ V185), R205 (= R199), W209 (≠ L203)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
33% identity, 78% coverage: 11:248/307 of query aligns to 5:254/468 of P27000
Sites not aligning to the query:
- 358 R→Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
33% identity, 78% coverage: 11:248/307 of query aligns to 5:254/468 of 1g59A
- binding : D44 (= D50), R45 (≠ Q51), A46 (≠ P52), R47 (= R53), P109 (≠ R107), V145 (vs. gap), R163 (≠ Q156), V166 (≠ I159), E172 (= E166), V177 (≠ I171), K180 (≠ R174), S181 (≠ A175), D182 (= D176), E207 (≠ A201), E208 (≠ D202), R237 (≠ V231), K241 (≠ G235), T242 (≠ E236), K243 (= K237)
Sites not aligning to the query:
- binding : 273, 274, 282, 299, 300, 303, 304, 309, 312, 319, 357, 358, 417, 426, 427, 432, 435, 442, 443, 444, 445, 446, 447, 448
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
31% identity, 70% coverage: 11:226/307 of query aligns to 14:228/455 of 3aiiA
Sites not aligning to the query:
4h3sA The structure of glutaminyl-tRNA synthetase from saccharomyces cerevisiae (see paper)
28% identity, 34% coverage: 9:111/307 of query aligns to 39:140/585 of 4h3sA
Sites not aligning to the query:
Query Sequence
>WP_041100790.1 NCBI__GCF_000828635.1:WP_041100790.1
MTTARHAYRGRFAPSPTGPLHFGSLVAAVGSYLEAKTRGGEWLLRMEDVDQPRCSMAAAD
EILRVLEVCGLAWDGEVVWQSRRTEAYAAALERLKAAGRVFPCGCTRRELADSAIAPDGA
AIYPGTCRAGLPAGREARAWRLRVGDARIGFDDAIQGRIVSDLAGEAGDFILLRADGLFA
YQLAVVVDDADAGITHVVRGADLLASTSRQIFLQQCLGAPTPGYAHLPVVVNASGEKLSK
QTRAAPVDISRPGLALFAALEFLGQRPPRELSGATVAEIWAWARANWQLVRVPRGPARAG
SVQNAGQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory