SitesBLAST
Comparing WP_041304058.1 NCBI__GCF_000092905.1:WP_041304058.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04181 Ornithine aminotransferase, mitochondrial; Ornithine delta-aminotransferase; Ornithine--oxo-acid aminotransferase; EC 2.6.1.13 from Homo sapiens (Human) (see 8 papers)
51% identity, 98% coverage: 1:385/394 of query aligns to 43:432/439 of P04181
- G51 (= G9) to D: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs11553554
- Y55 (= Y13) to H: in HOGA; decreased protein abundance; dbSNP:rs121965037
- N89 (= N47) to K: in HOGA; no effect on protein abundance; dbSNP:rs386833602
- Q90 (= Q48) to E: in HOGA; mistargeted, accumulates in cytoplasm; dbSNP:rs121965060
- C93 (≠ R51) to F: in HOGA; no effect on protein abundance; dbSNP:rs121965038
- Q104 (= Q62) to R: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs386833604
- R154 (= R112) to L: in HOGA; no effect on protein abundance; loss of ornithine aminotransferase activity; dbSNP:rs121965039
- R180 (= R138) to T: in HOGA; no effect on protein abundance; loss of ornithine aminotransferase activity; dbSNP:rs121965040
- A184 (≠ V142) natural variant: Missing (in HOGA; no effect on protein abundance; loss of ornithine aminotransferase activity; dbSNP:rs121965035)
- P199 (= P157) to Q: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs267606925
- A226 (≠ G183) to V: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs121965059
- P241 (= P198) to L: in HOGA; no effect on protein abundance; dbSNP:rs121965051
- Y245 (= Y202) to C: in HOGA; no effect on protein abundance; dbSNP:rs121965046
- R250 (= R207) to P: in HOGA; no effect on protein abundance; dbSNP:rs121965052
- T267 (= T224) to I: in HOGA; decreased protein abundance; dbSNP:rs386833618
- A270 (≠ G227) to P: decreased protein abundance; dbSNP:rs121965041
- R271 (= R228) to K: in HOGA; no effect on protein abundance; loss of ornithine aminotransferase activity; dbSNP:rs121965042
- K292 (= K249) modified: N6-(pyridoxal phosphate)lysine
- E318 (≠ S275) to K: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs386833621
- V332 (= V289) to M: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs121965047
- G353 (= G310) to D: in HOGA; decreased protein abundance; dbSNP:rs121965053
- G375 (= G332) to A: in HOGA; decreased protein abundance; dbSNP:rs121965045
- C394 (= C347) to R: in HOGA; no effect on protein abundance; dbSNP:rs121965054; to Y: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs386833597
- L402 (= L355) to P: in HOGA; may affect protein stability; loss of ornithine aminotransferase activity; dbSNP:rs121965043
- P417 (= P370) to L: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs121965044
Sites not aligning to the query:
- 1:35 modified: transit peptide, Mitochondrion; in renal form
- 436 I → N: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs386833598
- 437 L → F: in HOGA; likely benign; no effect on protein stability; no effect on ornithine aminotransferase activity; dbSNP:rs1800456
8ez1B Human ornithine aminotransferase (hoat) co-crystallized with its inactivator 3-amino-4-fluorocyclopentenecarboxylic acid (see paper)
51% identity, 98% coverage: 1:385/394 of query aligns to 6:395/402 of 8ez1B
- binding (1R,3S,4Z)-3-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-4-iminocyclopentane-1-carboxylic acid: Y48 (= Y43), T104 (= T99), G105 (= G100), V106 (≠ T101), F140 (= F135), W141 (≠ H136), E198 (= E192), D226 (= D220), I228 (= I222), Q229 (= Q223), K255 (= K249), R376 (= R366)
8ez1A Human ornithine aminotransferase (hoat) co-crystallized with its inactivator 3-amino-4-fluorocyclopentenecarboxylic acid (see paper)
51% identity, 98% coverage: 1:385/394 of query aligns to 6:395/402 of 8ez1A
- binding (3E,4E)-4-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-3-iminocyclopent-1-ene-1-carboxylic acid: Y48 (= Y43), G105 (= G100), V106 (≠ T101), F140 (= F135), W141 (≠ H136), E198 (= E192), D226 (= D220), I228 (= I222), Q229 (= Q223), K255 (= K249), R376 (= R366)
7tfpC Human ornithine aminotransferase cocrystallized with its inhibitor, (1s,3s)-3-amino-4-(difluoromethylene)cyclopentane-1-carboxylic acid. (see paper)
51% identity, 98% coverage: 1:385/394 of query aligns to 6:395/402 of 7tfpC
- binding (1S,3S,4S)-3-amino-4-(fluoromethyl)cyclopentane-1-carboxylic acid: Y18 (= Y13), Y48 (= Y43), F140 (= F135), E198 (= E192), K255 (= K249), R376 (= R366)
- binding pyridoxal-5'-phosphate: G105 (= G100), V106 (≠ T101), F140 (= F135), W141 (≠ H136), D226 (= D220), I228 (= I222), Q229 (= Q223), K255 (= K249)
7lk0A Ornithine aminotransferase (oat) cocrystallized with its potent inhibitor - (s)-3-amino-4,4-difluorocyclopent-1-enecarboxylic acid (ss-1-148) (see paper)
51% identity, 98% coverage: 1:385/394 of query aligns to 6:395/402 of 7lk0A
- binding (1R,3S)-3-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-oxocyclopentane-1-carboxylic acid: Y18 (= Y13), Y48 (= Y43), G105 (= G100), V106 (≠ T101), F140 (= F135), W141 (≠ H136), E198 (= E192), D226 (= D220), I228 (= I222), Q229 (= Q223), K255 (= K249)
7jx9A The crystal structure of human ornithine aminotransferase with an intermediate bound during inactivation by (1s,3s)-3-amino-4- (hexafluoropropan-2-ylidenyl)-cyclopentane-1-carboxylic acid. (see paper)
51% identity, 98% coverage: 1:385/394 of query aligns to 6:395/402 of 7jx9A
- active site: F140 (= F135), E193 (= E187), D226 (= D220), Q229 (= Q223), K255 (= K249), T285 (= T279), R376 (= R366)
- binding (1S,3S,4S)-3-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-(1,1,3,3,3-pentafluoroprop-1-en-2-yl)cyclopentane-1-carboxylic acid: Y18 (= Y13), Y48 (= Y43), G105 (= G100), V106 (≠ T101), F140 (= F135), W141 (≠ H136), E198 (= E192), D226 (= D220), I228 (= I222), Q229 (= Q223), K255 (= K249), R376 (= R366)
- binding N-[1,3-dihydroxy-2-(hydroxymethyl)propan-2-yl]glycine: S149 (= S144), F163 (≠ L158), M164 (≠ T159), P165 (= P160), F167 (= F162), R180 (= R175), A181 (= A176)
6v8dA Design, synthesis, and mechanism of fluorine-substituted cyclohexene analogues of gama-aminobutyric acid (gaba) as selective ornithine aminotransferase inactivators
51% identity, 98% coverage: 1:385/394 of query aligns to 6:395/402 of 6v8dA
- active site: F140 (= F135), E193 (= E187), D226 (= D220), Q229 (= Q223), K255 (= K249), T285 (= T279), R376 (= R366)
- binding (3Z)-3-iminocyclohex-1-ene-1-carboxylic acid: Y48 (= Y43), K255 (= K249)
- binding pyridoxal-5'-phosphate: T104 (= T99), G105 (= G100), V106 (≠ T101), W141 (≠ H136), D226 (= D220), I228 (= I222), Q229 (= Q223), K255 (= K249)
2canA Human ornithine aminotransferase complexed with l-canaline (see paper)
51% identity, 98% coverage: 1:385/394 of query aligns to 6:395/402 of 2canA
- active site: F140 (= F135), E193 (= E187), D226 (= D220), Q229 (= Q223), K255 (= K249), T285 (= T279), R376 (= R366)
- binding canaline: Y18 (= Y13), F140 (= F135), R143 (= R138), G283 (= G277), S284 (= S278)
- binding pyridoxal-5'-phosphate: G105 (= G100), V106 (≠ T101), F140 (= F135), W141 (≠ H136), D226 (= D220), I228 (= I222), Q229 (= Q223), K255 (= K249)
1gbnB Human ornithine aminotransferase complexed with the neurotoxin gabaculine (see paper)
51% identity, 98% coverage: 1:385/394 of query aligns to 6:395/402 of 1gbnB
- active site: F140 (= F135), E193 (= E187), D226 (= D220), Q229 (= Q223), K255 (= K249), T285 (= T279), R376 (= R366)
- binding gabaculine: Y18 (= Y13), Y48 (= Y43), F140 (= F135), E198 (= E192), K255 (= K249)
- binding pyridoxal-5'-phosphate: G105 (= G100), V106 (≠ T101), F140 (= F135), W141 (≠ H136), D226 (= D220), I228 (= I222), K255 (= K249)
1gbnA Human ornithine aminotransferase complexed with the neurotoxin gabaculine (see paper)
51% identity, 98% coverage: 1:385/394 of query aligns to 6:395/402 of 1gbnA
- active site: F140 (= F135), E193 (= E187), D226 (= D220), Q229 (= Q223), K255 (= K249), T285 (= T279), R376 (= R366)
- binding 3-aminobenzoic acid: Y18 (= Y13), Y48 (= Y43), E198 (= E192), K255 (= K249)
- binding pyridoxal-5'-phosphate: G105 (= G100), V106 (≠ T101), F140 (= F135), W141 (≠ H136), D226 (= D220), I228 (= I222), K255 (= K249)
7ta0A Human ornithine aminotransferase (hoat) soaked with 5-aminovaleric acid (see paper)
51% identity, 98% coverage: 1:385/394 of query aligns to 7:396/403 of 7ta0A
- binding 5-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]pentanoic acid: Y19 (= Y13), Y49 (= Y43), G106 (= G100), V107 (≠ T101), F141 (= F135), W142 (≠ H136), D227 (= D220), I229 (= I222), Q230 (= Q223), K256 (= K249), S285 (= S278), T286 (= T279)
7tedA Human ornithine aminotransferase cocrystallized with its inhibitor, (s,e)-3-amino-4-(fluoromethylene)cyclopent-1-ene-1-carboxylate (see paper)
51% identity, 98% coverage: 1:385/394 of query aligns to 8:397/404 of 7tedA
- binding (1S,3R,4S)-3-formyl-4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]cyclopentane-1-carboxylic acid: Y20 (= Y13), Y50 (= Y43), G107 (= G100), V108 (≠ T101), F142 (= F135), W143 (≠ H136), G144 (= G137), E200 (= E192), D228 (= D220), I230 (= I222), Q231 (= Q223), K257 (= K249), S286 (= S278), T287 (= T279)
7ta1A Human ornithine aminotransferase (hoat) soaked with gamma-aminobutyric acid (see paper)
51% identity, 98% coverage: 1:385/394 of query aligns to 8:397/404 of 7ta1A
7lnmB Ornithine aminotransferase (oat) cocrystallized with its inactivator - (1s,3s)-3-amino-4-(difluoromethylene)cyclopentene-1-carboxylic acid (see paper)
51% identity, 98% coverage: 1:385/394 of query aligns to 8:397/404 of 7lnmB
- binding (1~{R},3~{S},4~{R})-3-methyl-4-[[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylamino]cyclopentane-1-carboxylic acid: Y50 (= Y43), G107 (= G100), V108 (≠ T101), F142 (= F135), W143 (≠ H136), D228 (= D220), I230 (= I222), Q231 (= Q223), K257 (= K249)
7lk1A Ornithine aminotransferase (oat) with its potent inhibitor - (s)-3- amino-4,4-difluorocyclopent-1-enecarboxylic acid (ss-1-148) - 1 hour soaking (see paper)
51% identity, 98% coverage: 1:385/394 of query aligns to 8:397/404 of 7lk1A
- binding (1R,4R)-4-fluoro-3-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]cyclopent-2-ene-1-carboxylic acid: Y50 (= Y43), G107 (= G100), V108 (≠ T101), F142 (= F135), W143 (≠ H136), E200 (= E192), D228 (= D220), I230 (= I222), Q231 (= Q223), K257 (= K249), R378 (= R366)
6v8cA Design, synthesis, and mechanism of fluorine-substituted cyclohexene analogues of gama-aminobutyric acid (gaba) as selective ornithine aminotransferase inactivators
51% identity, 98% coverage: 1:385/394 of query aligns to 8:397/404 of 6v8cA
- active site: F142 (= F135), E195 (= E187), D228 (= D220), Q231 (= Q223), K257 (= K249), T287 (= T279), R378 (= R366)
- binding pyridoxal-5'-phosphate: G107 (= G100), V108 (≠ T101), F142 (= F135), W143 (≠ H136), D228 (= D220), I230 (= I222), K257 (= K249)
- binding 3-aminocyclohexa-1,3-diene-1-carboxylic acid: Y20 (= Y13), Y50 (= Y43), F142 (= F135), K257 (= K249)
6oiaA (1s,3s)-3-amino-4-(perfluoropropan-2-ylidene)cyclopentane-1-carboxylic acid hydrochloride, a potent inhibitor of ornithine aminotransferase (see paper)
51% identity, 98% coverage: 1:385/394 of query aligns to 8:397/404 of 6oiaA
- active site: F142 (= F135), E195 (= E187), D228 (= D220), Q231 (= Q223), K257 (= K249), T287 (= T279), R378 (= R366)
- binding (1S)-3-amino-4-[(2S)-1,1,1-trifluoro-3-oxopropan-2-yl]cyclopent-3-ene-1-carboxylic acid: S286 (= S278), T287 (= T279)
- binding pyridoxal-5'-phosphate: G107 (= G100), V108 (≠ T101), F142 (= F135), W143 (≠ H136), D228 (= D220), I230 (= I222), K257 (= K249)
5vwoA Ornithine aminotransferase inactivated by (1r,3s,4s)-3-amino-4- fluorocyclopentane-1-carboxylic acid (fcp) (see paper)
51% identity, 98% coverage: 1:385/394 of query aligns to 8:397/404 of 5vwoA
- active site: F142 (= F135), E195 (= E187), D228 (= D220), Q231 (= Q223), K257 (= K249), T287 (= T279), R378 (= R366)
- binding (1S,3S,4E)-3-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-4-iminocyclopentane-1-carboxylic acid: Y50 (= Y43), G107 (= G100), V108 (≠ T101), F142 (= F135), W143 (≠ H136), G144 (= G137), R145 (= R138), E200 (= E192), D228 (= D220), I230 (= I222), Q231 (= Q223), K257 (= K249)
2oatA Ornithine aminotransferase complexed with 5-fluoromethylornithine (see paper)
51% identity, 98% coverage: 1:385/394 of query aligns to 8:397/404 of 2oatA
- active site: F142 (= F135), E195 (= E187), D228 (= D220), Q231 (= Q223), K257 (= K249), T287 (= T279), R378 (= R366)
- binding 1-amino-7-(2-methyl-3-oxido-5-((phosphonoxy)methyl)-4-pyridoxal-5-oxo-6-heptenate: Y20 (= Y13), G107 (= G100), V108 (≠ T101), F142 (= F135), W143 (≠ H136), R145 (= R138), E195 (= E187), E200 (= E192), D228 (= D220), Q231 (= Q223), K257 (= K249), G285 (= G277), T287 (= T279)
2byjA Ornithine aminotransferase mutant y85i (see paper)
51% identity, 98% coverage: 1:385/394 of query aligns to 8:397/404 of 2byjA
- active site: F142 (= F135), E195 (= E187), D228 (= D220), Q231 (= Q223), K257 (= K249), T287 (= T279), R378 (= R366)
- binding pyridoxal-5'-phosphate: G107 (= G100), V108 (≠ T101), F142 (= F135), W143 (≠ H136), D228 (= D220), I230 (= I222), Q231 (= Q223), K257 (= K249)
Query Sequence
>WP_041304058.1 NCBI__GCF_000092905.1:WP_041304058.1
MIEREDRYGARNYDPLPVVLTKGEGVWVEDVEGRRYLDMLSAYSALNQGHRHPRIIQALK
AQADRITLTSRAFYNDKLGFFYERLAQLTHKDTILPMNTGTEAVETAIKAMRRWAYRVRG
VPEDQAEIIVATGNFHGRTTTVISFSSEPEYREGFGPLTPGFRVVPYGDIEALRRAAGPH
TAGVLLEPIQGEAGIVLPPDGYLREVRRICTENGIVFAADEIQTGLGRTGQWFACDWENV
TPDLYILGKALGGGVYPVSAVAANRDILGVFEPGSHGSTFGGNPLAAAVAVTALQVIEDE
KLVDRSRELGAYFLVRLRTLRHPAIREVRGRGLFIGLELTSPARPYCEKLKNRGLLCKET
HETTIRFAPPLVIQKEELDWAFEQIAEVFRPEAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory