SitesBLAST
Comparing WP_041376800.1 NCBI__GCF_000015505.1:WP_041376800.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4yi7A Anthranilate bound at active site of anthranilate phosphoribosyl transferase from acinetobacter (anprt; trpd)
42% identity, 96% coverage: 11:344/348 of query aligns to 6:328/331 of 4yi7A
5nofA Anthranilate phosphoribosyltransferase from thermococcus kodakaraensis (see paper)
41% identity, 87% coverage: 42:344/348 of query aligns to 31:325/325 of 5nofA
1kgzB Crystal structure analysis of the anthranilate phosphoribosyltransferase from erwinia carotovora (current name, pectobacterium carotovorum) (see paper)
39% identity, 94% coverage: 13:339/348 of query aligns to 6:328/330 of 1kgzB
- binding manganese (ii) ion: S92 (= S100), D222 (= D233), E223 (= E234), E223 (= E234)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V79 (= V87), G82 (= G90), G83 (= G91), N90 (= N98), I91 (= I99), S92 (= S100), T93 (= T101), K108 (= K116), S118 (= S128)
1zxyA Anthranilate phosphoribosyltransferase from sulfolobus solfataricus in complex with prpp and magnesium (see paper)
37% identity, 91% coverage: 10:327/348 of query aligns to 4:317/344 of 1zxyA
- binding magnesium ion: D223 (= D233), E224 (= E234)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: A78 (≠ V87), G79 (= G88), D83 (= D92), T87 (= T96), N89 (= N98), S91 (= S100), T92 (= T101), K106 (= K116), S118 (= S128), D223 (= D233), E224 (= E234)
2gvqD Anthranilate phosphoribosyl-transferase (trpd) from s. Solfataricus in complex with anthranilate (see paper)
37% identity, 91% coverage: 10:327/348 of query aligns to 4:317/345 of 2gvqD
P50384 Anthranilate phosphoribosyltransferase; EC 2.4.2.18 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 2 papers)
37% identity, 91% coverage: 10:327/348 of query aligns to 4:317/345 of P50384
- T87 (= T96) binding
- K106 (= K116) mutation to Q: Affinity for phosphoribosylpyrophosphate is similar to that of the wild-type enzyme and catalytic efficiency dedreases only 10-fold.
- H107 (= H117) mutation to A: Limited effect on either affinity for anthranilate and catalytic efficiency. 300-fold decrease of the affinity for anthranilate, whereas catalytic efficiency remains nearly unchanged; when associated with A-178.
- S118 (= S128) binding
- H154 (= H164) mutation to A: Limited effect on either affinity for anthranilate and catalytic efficiency.
- R164 (= R174) mutation to A: Strong decrease of the affinity for anthranilate, although only a moderate 7-fold decrease in catalytic efficiency.
- D223 (= D233) mutation to N: Affinity for phosphoribosylpyrophosphate is similar to that of the wild-type enzyme and catalytic efficiency is unchanged.
- E224 (= E234) mutation to Q: Affinity for phosphoribosylpyrophosphate is similar to that of the wild-type enzyme and catalytic efficiency is unchanged.
5c1rA Stereoisomer of prpp bound in the active site of mycobacterium tuberculosis anthranilate phosphoribosyl (anprt; trpd)
37% identity, 95% coverage: 13:343/348 of query aligns to 7:342/343 of 5c1rA
- active site: V82 (= V87)
- binding 5-O-[(R)-hydroxy(phosphonooxy)phosphoryl]-1-O-phosphono-alpha-D-ribofuranose: V82 (= V87), G83 (= G88), G86 (= G91), N93 (= N98), S95 (= S100), T96 (= T101), K111 (= K116), R115 (= R120), A117 (≠ V122), S118 (= S123), S119 (= S124)
- binding magnesium ion: D87 (= D92), V89 (≠ S94), S95 (= S100), E228 (= E234)
3r88B Anthranilate phosphoribosyltransferase (trpd) from mycobacterium tuberculosis (complex with inhibitor acs145) (see paper)
37% identity, 96% coverage: 11:343/348 of query aligns to 5:342/344 of 3r88B
- active site: V82 (= V87)
- binding 2-amino-4,5-dimethoxybenzoic acid: N114 (≠ G119), A155 (= A160), P156 (= P161), H159 (= H164), Y162 (≠ M167), R163 (≠ K168), A166 (= A171)
- binding magnesium ion: S95 (= S100), D227 (= D233), E228 (= E234), E228 (= E234)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V82 (= V87), G83 (= G88), G85 (= G90), G86 (= G91), N93 (= N98), S95 (= S100), T96 (= T101), K111 (= K116), N114 (≠ G119), A117 (≠ V122), S118 (= S123), S119 (= S124)
4n5vA Alternative substrates of mycobacterium tuberculosis anthranilate phosphoribosyl transferase (see paper)
37% identity, 96% coverage: 11:343/348 of query aligns to 7:345/347 of 4n5vA
- active site: V84 (= V87)
- binding 2-amino-4-fluorobenzoic acid: V84 (= V87), G85 (= G88), H114 (= H117), G115 (= G118), N116 (≠ G119), A157 (= A160), A157 (= A160), P158 (= P161), H161 (= H164), Y164 (≠ M167), R165 (≠ K168), A168 (= A171), R171 (= R174), G184 (= G187)
- binding magnesium ion: S97 (= S100), D229 (= D233), E230 (= E234), E230 (= E234)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G85 (= G88), G87 (= G90), G88 (= G91), N95 (= N98), S97 (= S100), T98 (= T101), K113 (= K116), A119 (≠ V122), S120 (= S123), S121 (= S124), G124 (= G127)
P9WFX5 Anthranilate phosphoribosyltransferase; EC 2.4.2.18 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
37% identity, 95% coverage: 13:343/348 of query aligns to 31:368/370 of P9WFX5
- G107 (= G88) binding
- T115 (= T96) binding
- G147 (≠ S128) binding
4n93A Alternative substrates of mycobacterium tuberculosis anthranilate phosphoribosyl transferase (see paper)
37% identity, 96% coverage: 11:343/348 of query aligns to 6:344/346 of 4n93A
- active site: V83 (= V87)
- binding 2-amino-6-methylbenzoic acid: V83 (= V87), G84 (= G88), T85 (= T89), H113 (= H117), N115 (≠ G119), N115 (≠ G119), A156 (= A160), P157 (= P161), H160 (= H164), Y163 (≠ M167), A167 (= A171), R170 (= R174), G183 (= G187), P184 (= P188)
- binding magnesium ion: S96 (= S100), D228 (= D233), E229 (= E234), E229 (= E234)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G84 (= G88), G86 (= G90), G87 (= G91), N94 (= N98), S96 (= S100), T97 (= T101), K112 (= K116), A117 (≠ S121), A118 (≠ V122), S120 (= S124), G123 (= G127)
4owoA Anthranilate phosphoribosyl transferase from mycobacterium tuberculosis in complex with 6-fluoroanthranilate, prpp and magnesium (see paper)
37% identity, 96% coverage: 11:343/348 of query aligns to 7:346/348 of 4owoA
- active site: V84 (= V87)
- binding 2-azanyl-6-fluoranyl-benzoic acid: V84 (= V87), G85 (= G88), T86 (= T89), H114 (= H117), N116 (≠ G119), N116 (≠ G119), A157 (= A160), P158 (= P161), H161 (= H164), Y164 (≠ M167), A168 (= A171), R171 (= R174), G184 (= G187)
- binding magnesium ion: S97 (= S100), D229 (= D233), E230 (= E234), E230 (= E234)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V84 (= V87), G85 (= G88), G87 (= G90), G88 (= G91), N95 (= N98), S97 (= S100), T98 (= T101), K113 (= K116), A118 (≠ S121), A119 (≠ V122), S120 (= S123), S121 (= S124), G124 (= G127)
4giuA Bianthranilate-like analogue bound in inner site of anthranilate phosphoribosyltransferase (anprt; trpd). (see paper)
37% identity, 96% coverage: 11:343/348 of query aligns to 6:345/346 of 4giuA
- active site: V83 (= V87)
- binding 2-[(2-carboxy-5-methylphenyl)amino]-3-methylbenzoic acid: G114 (= G118), N115 (≠ G119), A156 (= A160), H160 (= H164), Y163 (≠ M167), R170 (= R174), G183 (= G187)
- binding magnesium ion: S96 (= S100), D228 (= D233), E229 (= E234), E229 (= E234)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G84 (= G88), G86 (= G90), G87 (= G91), N94 (= N98), S96 (= S100), T97 (= T101), K112 (= K116), N115 (≠ G119), A117 (≠ S121), A118 (≠ V122), S119 (= S123), S120 (= S124), G123 (= G127)
5c2lA Magnesium soaked into the active site of mycobacterium tuberculosis anthranilate phosphoribosyltransferase (anprt; trpd)
37% identity, 96% coverage: 11:343/348 of query aligns to 7:346/349 of 5c2lA
4owuA Anthranilate phosphoribosyl transferase from mycobacterium tuberculosis in complex with 5-methylanthranilate, prpp and magnesium (see paper)
37% identity, 96% coverage: 11:343/348 of query aligns to 6:345/347 of 4owuA
- active site: V83 (= V87)
- binding 2-azanyl-5-methyl-benzoic acid: N115 (≠ G119), P157 (= P161), Y163 (≠ M167), R164 (≠ K168), A167 (= A171)
- binding magnesium ion: S96 (= S100), D228 (= D233), E229 (= E234), E229 (= E234)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G84 (= G88), G86 (= G90), G87 (= G91), N94 (= N98), S96 (= S100), T97 (= T101), K112 (= K116), A118 (≠ V122), S120 (= S124), G123 (= G127)
4owqA Anthranilate phosphoribosyl transferase from mycobacterium tuberculosis in complex with 3-methylanthranilate, prpp and magnesium (see paper)
37% identity, 96% coverage: 11:343/348 of query aligns to 6:345/347 of 4owqA
- active site: V83 (= V87)
- binding 2-azanyl-3-methyl-benzoic acid: P157 (= P161), H160 (= H164), Y163 (≠ M167), A167 (= A171), R171 (≠ K175)
- binding magnesium ion: S96 (= S100), D228 (= D233), E229 (= E234), E229 (= E234)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V83 (= V87), G84 (= G88), G86 (= G90), G87 (= G91), N94 (= N98), S96 (= S100), T97 (= T101), K112 (= K116), A117 (≠ S121), A118 (≠ V122), S120 (= S124), G123 (= G127)
4owmA Anthranilate phosphoribosyl transferase from mycobacterium tuberculosis in complex with 3-fluoroanthranilate, prpp and magnesium (see paper)
37% identity, 96% coverage: 11:343/348 of query aligns to 5:344/346 of 4owmA
- active site: V82 (= V87)
- binding 2-azanyl-3-fluoranyl-benzoic acid: P156 (= P161), H159 (= H164), Y162 (≠ M167), R163 (≠ K168), A166 (= A171), R170 (≠ K175)
- binding magnesium ion: S95 (= S100), D227 (= D233), E228 (= E234), E228 (= E234)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G88), G86 (= G91), N93 (= N98), S95 (= S100), T96 (= T101), K111 (= K116), A117 (≠ V122), S118 (= S123), S119 (= S124), G122 (= G127)
4gkmA Bianthranilate-like analogue bound in the outer site of anthranilate phosphoribosyltransferase (anprt; trpd) (see paper)
37% identity, 96% coverage: 11:343/348 of query aligns to 5:344/346 of 4gkmA
- active site: V82 (= V87)
- binding 2-[(2-carboxyphenyl)amino]-5-methylbenzoic acid: N114 (≠ G119), A155 (= A160), P156 (= P161), Y162 (≠ M167), R163 (≠ K168), A166 (= A171), R169 (= R174), R170 (≠ K175)
- binding magnesium ion: S95 (= S100), D227 (= D233), E228 (= E234), E228 (= E234)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G86 (= G91), N93 (= N98), S95 (= S100), T96 (= T101), K111 (= K116), A117 (≠ V122), S118 (= S123), S119 (= S124), G122 (= G127)
3r6cA Anthranilate phosphoribosyltransferase (trpd) from mycobacterium tuberculosis (complex with inhibitor acs179) (see paper)
37% identity, 96% coverage: 11:343/348 of query aligns to 5:344/346 of 3r6cA
- active site: V82 (= V87)
- binding 8-methoxyphenanthro[3,4-d][1,3]dioxole-5,6-dicarboxylic acid: M62 (= M68), N114 (≠ G119), A155 (= A160), P156 (= P161), H159 (= H164), Y162 (≠ M167), A166 (= A171), R169 (= R174), G182 (= G187), T185 (= T190), R239 (≠ E245), A241 (≠ K247), D246 (≠ T252), V301 (≠ Y307), A310 (= A309), W312 (≠ V311)
- binding magnesium ion: S95 (= S100), D227 (= D233), E228 (= E234), E228 (= E234)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G88), G85 (= G90), G86 (= G91), N93 (= N98), S95 (= S100), T96 (= T101), K111 (= K116), N114 (≠ G119), R115 (= R120), A116 (≠ S121), A117 (≠ V122), S118 (= S123), S119 (= S124), G122 (= G127), G123 (≠ S128)
3qsaA Anthranilate phosphoribosyltransferase (trpd) from mycobacterium tuberculosis (complex with inhibitor tamu-a7)
37% identity, 96% coverage: 11:343/348 of query aligns to 5:344/346 of 3qsaA
- active site: V82 (= V87)
- binding magnesium ion: S95 (= S100), D227 (= D233), E228 (= E234), E228 (= E234)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G88), G86 (= G91), N93 (= N98), S95 (= S100), T96 (= T101), K111 (= K116), A117 (≠ V122), S118 (= S123), S119 (= S124), G122 (= G127)
- binding 4,4,4-trifluoro-1-(4-methoxyphenyl)butane-1,3-dione: M62 (= M68), N114 (≠ G119), A155 (= A160), P156 (= P161), H159 (= H164), Y162 (≠ M167), R163 (≠ K168), A166 (= A171), G182 (= G187)
Query Sequence
>WP_041376800.1 NCBI__GCF_000015505.1:WP_041376800.1
MPNSHKITASEALQRTIEHREIFHDEMLHIMRLIMSGEMSPLMTAALITGLRVKKETIGE
ITAAAQVMREFSTKVHVADKTHLVDIVGTGGDGSHTFNISTCAMFVAASAGARVSKHGGR
SVSSKSGSADVVESLGISLNLSPEAIARCIEEVGVGFMFAPNHHPAMKNVAPVRKELGIR
TIFNILGPLTNPASAPNILMGVFHPDLVGIQVRALQRLGAEHALVVYGKDGMDEVSLGAA
TVVGELKDGEITEYEIHPEDFGIPMASNRALRVETPEQSKAMLLGVLDNQPGAPRDIVIL
NAGAALYAANVVNSMKDGMDRAQAAIESGAARRKLAQLAEFSQSASGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory