Comparing WP_041532230.1 NCBI__GCF_000015045.1:WP_041532230.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4delA Active site loop dynamics of a class iia fructose 1,6-bisphosphate aldolase from m. Tuberculosis (see paper)
56% identity, 99% coverage: 2:338/341 of query aligns to 1:341/345 of 4delA
Sites not aligning to the query:
3ekzA Structural characterization of tetrameric mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase - substrate binding and catalysis mechanism of a class iia bacterial aldolase (see paper)
55% identity, 99% coverage: 2:338/341 of query aligns to 1:330/334 of 3ekzA
Sites not aligning to the query:
4a22A Structure of mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase bound to n-(4-hydroxybutyl)- glycolohydroxamic acid bis- phosphate (see paper)
54% identity, 99% coverage: 2:338/341 of query aligns to 1:328/329 of 4a22A
3elfA Structural characterization of tetrameric mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase - substrate binding and catalysis mechanism of a class iia bacterial aldolase (see paper)
54% identity, 99% coverage: 2:338/341 of query aligns to 1:328/332 of 3elfA
Sites not aligning to the query:
4lv4A A noncompetitive inhibitor for m. Tuberculosis's class iia fructose 1, 6-bisphosphate aldolase (see paper)
51% identity, 99% coverage: 2:338/341 of query aligns to 1:316/320 of 4lv4A
Sites not aligning to the query:
P0AB71 Fructose-bisphosphate aldolase class 2; FBP aldolase; FBPA; Fructose-1,6-bisphosphate aldolase; Fructose-bisphosphate aldolase class II; Sedoheptulose bisphosphate aldolase; EC 4.1.2.13 from Escherichia coli (strain K12) (see 11 papers)
41% identity, 95% coverage: 10:332/341 of query aligns to 19:354/359 of P0AB71
Sites not aligning to the query:
1dosA Structure of fructose-bisphosphate aldolase (see paper)
40% identity, 95% coverage: 10:332/341 of query aligns to 18:353/358 of 1dosA
1b57A Class ii fructose-1,6-bisphosphate aldolase in complex with phosphoglycolohydroxamate (see paper)
39% identity, 95% coverage: 10:332/341 of query aligns to 18:341/346 of 1b57A
3qm3A 1.85 angstrom resolution crystal structure of fructose-bisphosphate aldolase (fba) from campylobacter jejuni
40% identity, 96% coverage: 10:337/341 of query aligns to 19:350/350 of 3qm3A
5vjeA Class ii fructose-1,6-bisphosphate aldolase of escherichia coli with d-glucitol 1,6-bisphosphate (see paper)
38% identity, 96% coverage: 10:335/341 of query aligns to 18:337/339 of 5vjeA
5gk5C Apo structure of fructose 1,6-bisphosphate aldolase from escherichia coli at 1.9 angstrom resolution
36% identity, 96% coverage: 10:335/341 of query aligns to 18:333/335 of 5gk5C
1gynA Class ii fructose 1,6-bisphosphate aldolase with cadmium (not zinc) in the active site (see paper)
36% identity, 96% coverage: 10:335/341 of query aligns to 18:331/333 of 1gynA
P36580 Fructose-bisphosphate aldolase; FBP aldolase; FBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
36% identity, 96% coverage: 11:336/341 of query aligns to 19:357/358 of P36580
7rgnA Crystal structure of putative fructose-1,6-bisphosphate aldolase from candida auris
36% identity, 96% coverage: 10:335/341 of query aligns to 17:338/340 of 7rgnA
7v6gB Structure of candida albicans fructose-1,6-bisphosphate aldolase mutation c157s with cn39
36% identity, 94% coverage: 10:328/341 of query aligns to 17:329/338 of 7v6gB
Sites not aligning to the query:
7yvaB Crystal structure of candida albicans fructose-1,6-bisphosphate aldolase complexed with lipoic acid
35% identity, 94% coverage: 10:328/341 of query aligns to 17:327/336 of 7yvaB
Sites not aligning to the query:
7v6fA Structure of candida albicans fructose-1,6-bisphosphate aldolase complexed with g3p
35% identity, 94% coverage: 10:328/341 of query aligns to 17:326/335 of 7v6fA
P13243 Probable fructose-bisphosphate aldolase; FBP aldolase; FBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 from Bacillus subtilis (strain 168) (see paper)
26% identity, 99% coverage: 1:336/341 of query aligns to 1:284/285 of P13243
4to8A Methicillin-resistant staphylococcus aureus class iib fructose 1,6- bisphosphate aldolase (see paper)
28% identity, 97% coverage: 6:335/341 of query aligns to 2:275/279 of 4to8A
3q94A The crystal structure of fructose 1,6-bisphosphate aldolase from bacillus anthracis str. 'Ames ancestor'
27% identity, 90% coverage: 6:313/341 of query aligns to 3:261/285 of 3q94A
>WP_041532230.1 NCBI__GCF_000015045.1:WP_041532230.1
MPVADLTTYRRMLDRARENRFAYPAINVSSLATANAVLRGLAEARCDGIIQVSTGGAAFA
SGTALKDMPLGAISIAEHVHRAAQRYPIYVALHTDHCPADKLDSFVLPLVAETERRRAAG
LPNLFNSHMFDGSALALKDNLDTATRLLERFTACELILEIETGVVGGEEDGIKADASAKL
YTTPEETLEVARRLNPLGGHYLLAATFGNVHGVYKPGAVKLRPSVLKECQDAVVTRYGEA
ARFHLVFHGGSGSELHEIREALDYGVVKMNIDTDTQYAFTRPIAGHMFSHYDGVLKVDGD
MGDKKAYDPRTYLALAETAMAERVKRAVSDLRGTNSTLFTG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory