Comparing WP_041675826.1 NCBI__GCF_000021545.1:WP_041675826.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O66440 3-dehydroquinate dehydratase; 3-dehydroquinase; Type I DHQase; Type I dehydroquinase; DHQ1; EC 4.2.1.10 from Aquifex aeolicus (strain VF5) (see paper)
39% identity, 90% coverage: 16:233/242 of query aligns to 3:216/219 of O66440
Q6GII7 3-dehydroquinate dehydratase; 3-dehydroquinase; Type I DHQase; Type I dehydroquinase; DHQ1; EC 4.2.1.10 from Staphylococcus aureus (strain MRSA252) (see paper)
32% identity, 80% coverage: 34:226/242 of query aligns to 28:231/238 of Q6GII7
1sfjA 2.4a crystal structure of staphylococcus aureus type i 3- dehydroquinase, with 3-dehydroquinate bound (see paper)
32% identity, 80% coverage: 34:226/242 of query aligns to 22:220/227 of 1sfjA
8b2aBBB 3-dehydroquinate dehydratase (see paper)
31% identity, 80% coverage: 34:226/242 of query aligns to 28:231/238 of 8b2aBBB
6sfhA Crystal structure of dhq1 from staphylococcus aureus covalently modified by ligand 7 (see paper)
31% identity, 80% coverage: 34:226/242 of query aligns to 27:230/237 of 6sfhA
1l9wA Crystal structure of 3-dehydroquinase from salmonella typhi complexed with reaction product (see paper)
32% identity, 81% coverage: 38:234/242 of query aligns to 43:250/252 of 1l9wA
P05194 3-dehydroquinate dehydratase; 3-dehydroquinase; Type I DHQase; Type I dehydroquinase; DHQ1; EC 4.2.1.10 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 91% coverage: 15:234/242 of query aligns to 17:250/252 of P05194
P58687 3-dehydroquinate dehydratase; 3-dehydroquinase; DHQD; Type I DHQase; Type I dehydroquinase; DHQ1; EC 4.2.1.10 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
31% identity, 91% coverage: 15:234/242 of query aligns to 17:250/252 of P58687
4gujA 1.50 angstrom crystal structure of the salmonella enterica 3- dehydroquinate dehydratase (arod) in complex with shikimate (see paper)
31% identity, 91% coverage: 15:234/242 of query aligns to 16:249/251 of 4gujA
4guiA 1.78 angstrom crystal structure of the salmonella enterica 3- dehydroquinate dehydratase (arod) in complex with quinate (see paper)
31% identity, 91% coverage: 15:234/242 of query aligns to 16:249/251 of 4guiA
3m7wA Crystal structure of type i 3-dehydroquinate dehydratase (arod) from salmonella typhimurium lt2 in covalent complex with dehydroquinate (see paper)
31% identity, 91% coverage: 15:234/242 of query aligns to 16:249/251 of 3m7wA
Q186A6 3-dehydroquinate dehydratase; 3-dehydroquinase; Type I DHQase; Type I dehydroquinase; DHQ1; EC 4.2.1.10 from Clostridioides difficile (strain 630) (Peptoclostridium difficile) (see paper)
31% identity, 91% coverage: 15:234/242 of query aligns to 18:251/255 of Q186A6
3js3A Crystal structure of type i 3-dehydroquinate dehydratase (arod) from clostridium difficile with covalent reaction intermediate (see paper)
31% identity, 91% coverage: 15:234/242 of query aligns to 18:251/253 of 3js3A
4h3dB 1.95 angstrom crystal structure of of type i 3-dehydroquinate dehydratase (arod) from clostridium difficile with covalent modified comenic acid.
31% identity, 91% coverage: 15:234/242 of query aligns to 18:251/254 of 4h3dB
8b2cAAA 3-dehydroquinate dehydratase (see paper)
31% identity, 81% coverage: 38:234/242 of query aligns to 43:250/252 of 8b2cAAA
8b2bAAA 3-dehydroquinate dehydratase (see paper)
31% identity, 81% coverage: 38:234/242 of query aligns to 43:250/252 of 8b2bAAA
6sfeA Crystal structure of dhq1 from salmonella typhi covalently modified by compound 7 (see paper)
31% identity, 81% coverage: 38:234/242 of query aligns to 43:250/252 of 6sfeA
6h5jA Crystal structure of dhq1 from salmonella typhi covalently modified by ligand 4
31% identity, 81% coverage: 38:234/242 of query aligns to 43:250/252 of 6h5jA
6h5gA Crystal structure of dhq1 from salmonella typhi covalently modified by ligand 3
31% identity, 81% coverage: 38:234/242 of query aligns to 43:250/252 of 6h5gA
6h5cA Crystal structure of dhq1 from salmonella typhi covalently modified by ligand 1
31% identity, 81% coverage: 38:234/242 of query aligns to 43:250/252 of 6h5cA
>WP_041675826.1 NCBI__GCF_000021545.1:WP_041675826.1
MIKFKKLYGEKKVVKIAVPIIDENVENTLSIALLENVDIIELRIDQFKSKDLAHILGIIK
KVKEKGFIALATVRSKLEGGADIPDEERLKIFSSIADYVDMVDIEYTSFRINKEIVDLYH
SKGKAVIMSYHDFEKTPSDDYIQSIIDESKTLGADIVKYAFKANSFQDVARVMCITHRNR
EKNLVAILMGEIGKVSRVVAPVFGSLITYTFIGQSFAPGQIEVQKLNELLEFFNIQKGWK
LD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory