Comparing WP_041736272.1 NCBI__GCF_000092885.1:WP_041736272.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
P9WIB9 Secreted chorismate mutase; CM; *MtCM; EC 5.4.99.5 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 4 papers)
31% identity, 80% coverage: 34:186/191 of query aligns to 42:193/199 of P9WIB9
Sites not aligning to the query:
2ao2B The 2.07 angstrom crystal structure of mycobacterium tuberculosis chorismate mutase reveals unexpected gene duplication and suggests a role in host-pathogen interactions (see paper)
31% identity, 80% coverage: 34:186/191 of query aligns to 8:159/165 of 2ao2B
2ao2A The 2.07 angstrom crystal structure of mycobacterium tuberculosis chorismate mutase reveals unexpected gene duplication and suggests a role in host-pathogen interactions (see paper)
31% identity, 80% coverage: 34:186/191 of query aligns to 8:159/165 of 2ao2A
2fp2B Secreted chorismate mutase from mycobacterium tuberculosis (see paper)
31% identity, 80% coverage: 34:186/191 of query aligns to 6:157/163 of 2fp2B
Q7CHH5 Secreted chorismate mutase; CM; *YpCM; EC 5.4.99.5 from Yersinia pestis (see paper)
31% identity, 55% coverage: 33:137/191 of query aligns to 38:130/186 of Q7CHH5
Sites not aligning to the query:
>WP_041736272.1 NCBI__GCF_000092885.1:WP_041736272.1
MRRVCTRNAVTLALAVWLVTGCSAGAQQDAFLPLVRSMADRLNTADQVALNKWDTGQPVY
DPQREAQVIANAVAMASEYGLTTEDVTNIFSDQIEANKEIQYELLSNWMRQGNAPATPRQ
SLAGVIRPILDKLQANIMLNLKGVAPLRSNTDCQTQVATAVGRVAQQTSLDALHLAALDR
AVARICVTQTG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory