Comparing WP_041755826.1 NCBI__GCF_000013785.1:WP_041755826.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A799 Phosphoglycerate kinase; EC 2.7.2.3 from Escherichia coli (strain K12) (see 3 papers)
71% identity, 100% coverage: 1:385/386 of query aligns to 1:385/387 of P0A799
1zmrA Crystal structure of the e. Coli phosphoglycerate kinase (see paper)
71% identity, 99% coverage: 2:385/386 of query aligns to 1:384/386 of 1zmrA
4feyA An x-ray structure of a putative phosphogylcerate kinase with bound adp from francisella tularensis subsp. Tularensis schu s4
61% identity, 100% coverage: 1:385/386 of query aligns to 1:390/392 of 4feyA
4ng4B Structure of phosphoglycerate kinase (cbu_1782) from coxiella burnetii (see paper)
58% identity, 99% coverage: 4:385/386 of query aligns to 3:388/389 of 4ng4B
P40924 Phosphoglycerate kinase; EC 2.7.2.3 from Bacillus subtilis (strain 168) (see paper)
47% identity, 99% coverage: 1:384/386 of query aligns to 1:394/394 of P40924
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
47% identity, 98% coverage: 1:378/386 of query aligns to 1:391/654 of P36204
1vpeA Crystallographic analysis of phosphoglycerate kinase from the hyperthermophilic bacterium thermotoga maritima (see paper)
48% identity, 97% coverage: 5:378/386 of query aligns to 2:390/398 of 1vpeA
1phpA Structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms (see paper)
46% identity, 99% coverage: 1:384/386 of query aligns to 1:394/394 of 1phpA
P18912 Phosphoglycerate kinase; EC 2.7.2.3 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
46% identity, 99% coverage: 1:384/386 of query aligns to 1:394/394 of P18912
3zlbA Crystal structure of phosphoglycerate kinase from streptococcus pneumoniae (see paper)
43% identity, 99% coverage: 1:384/386 of query aligns to 1:398/398 of 3zlbA
P07378 Phosphoglycerate kinase, glycosomal; Phosphoglycerate kinase C; EC 2.7.2.3 from Trypanosoma brucei brucei (see 2 papers)
40% identity, 99% coverage: 6:386/386 of query aligns to 9:421/440 of P07378
16pkA Phosphoglycerate kinase from trypanosoma brucei bisubstrate analog (see paper)
40% identity, 98% coverage: 6:384/386 of query aligns to 5:415/415 of 16pkA
13pkA Ternary complex of phosphoglycerate kinase from trypanosoma brucei (see paper)
40% identity, 98% coverage: 6:384/386 of query aligns to 5:415/415 of 13pkA
O60101 Phosphoglycerate kinase; EC 2.7.2.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
43% identity, 99% coverage: 2:384/386 of query aligns to 5:414/414 of O60101
P00560 Phosphoglycerate kinase; EC 2.7.2.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
40% identity, 99% coverage: 4:384/386 of query aligns to 7:415/416 of P00560
2wzcA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp, 3pg and aluminium tetrafluoride (see paper)
39% identity, 98% coverage: 4:383/386 of query aligns to 5:404/405 of 2wzcA
2wzbA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp, 3pg and magnesium trifluoride (see paper)
39% identity, 98% coverage: 4:383/386 of query aligns to 5:404/405 of 2wzbA
P09041 Phosphoglycerate kinase 2; Phosphoglycerate kinase, testis specific; EC 2.7.2.3 from Mus musculus (Mouse) (see paper)
39% identity, 98% coverage: 4:383/386 of query aligns to 7:416/417 of P09041
3pgkA The structure of yeast phosphoglycerate kinase at 0.25 nm resolution (see paper)
41% identity, 99% coverage: 4:384/386 of query aligns to 6:414/415 of 3pgkA
1qpgA 3-phosphoglycerate kinase, mutation r65q (see paper)
40% identity, 99% coverage: 4:384/386 of query aligns to 6:414/415 of 1qpgA
>WP_041755826.1 NCBI__GCF_000013785.1:WP_041755826.1
MTVLKMTDLDLQGKRVLIREDLNVPVKDGAVKSDARILASLPTIKLALEKGAAVLVCSHL
GRPEEGVYSEEDSLKPVADYLSKALGREVPLVKDYLDGVEVQPGELVLLENVRFNKGEKK
NTDELAQKYAALCDVFVMDAFGTAHRAQGSTHGVAKFAKVACAGPLLAAELDALGKALDK
PQRPMVAIVAGSKVSTKLDVLTSLADICDQLIVGGGIANTFLAAAGYKVGKSLHEADLID
TAKAIAAKVAVPLPVDVVVAKEFAESAEATVKAIADVADDDMILDIGPKTAAMFGEMLKS
SQTILWNGPVGVFEFDQFGNGTKVLAQAIAQSPAFSIAGGGDTLAAIDKYGVAEQISYIS
TGGGAFLEFVEGKVLPAVEVLEQRAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory