SitesBLAST
Comparing WP_041936837.1 NCBI__GCF_000009265.1:WP_041936837.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
47% identity, 100% coverage: 1:313/313 of query aligns to 1:313/313 of Q65CJ7
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
48% identity, 98% coverage: 6:313/313 of query aligns to 4:311/311 of 3bazA
- active site: L98 (= L100), R230 (= R232), A251 (= A253), D254 (= D256), E259 (= E261), H277 (= H279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (= V76), G149 (= G151), L150 (≠ M152), G151 (= G153), R152 (= R154), I153 (= I155), S172 (≠ A174), R173 (= R175), S174 (≠ H176), C201 (≠ V203), P202 (= P204), T207 (= T209), I228 (≠ V230), G229 (≠ S231), R230 (= R232), D254 (= D256), H277 (= H279), G279 (= G281)
5v6qB Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and malonate (see paper)
52% identity, 86% coverage: 44:312/313 of query aligns to 42:310/319 of 5v6qB
- active site: L96 (= L100), R230 (= R232), D254 (= D256), E259 (= E261), H277 (= H279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V72 (= V76), V100 (= V104), F148 (≠ A150), L150 (≠ M152), G151 (= G153), R152 (= R154), I153 (= I155), T172 (≠ A174), R173 (= R175), V201 (= V203), P202 (= P204), S206 (≠ A208), T207 (= T209), V228 (= V230), G229 (≠ S231), R230 (= R232), H277 (= H279), A279 (≠ G281)
5v7gA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
52% identity, 86% coverage: 44:312/313 of query aligns to 40:308/317 of 5v7gA
- active site: L94 (= L100), R228 (= R232), D252 (= D256), E257 (= E261), H275 (= H279)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V70 (= V76), V98 (= V104), F146 (≠ A150), L148 (≠ M152), G149 (= G153), R150 (= R154), I151 (= I155), T170 (≠ A174), R171 (= R175), V199 (= V203), P200 (= P204), S204 (≠ A208), T205 (= T209), V226 (= V230), G227 (≠ S231), R228 (= R232), H275 (= H279), A277 (≠ G281)
- binding oxalate ion: G69 (= G75), V70 (= V76), G71 (= G77), R228 (= R232), H275 (= H279)
5v7nA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and 2-keto-d-gluconic acid (see paper)
52% identity, 86% coverage: 44:312/313 of query aligns to 41:309/319 of 5v7nA
- active site: L95 (= L100), R229 (= R232), D253 (= D256), E258 (= E261), H276 (= H279)
- binding 2-keto-D-gluconic acid: G70 (= G75), V71 (= V76), G72 (= G77), R229 (= R232), H276 (= H279), S279 (= S282), R285 (= R288)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V71 (= V76), V99 (= V104), L149 (≠ M152), G150 (= G153), R151 (= R154), I152 (= I155), T171 (≠ A174), R172 (= R175), V200 (= V203), P201 (= P204), S205 (≠ A208), T206 (= T209), V227 (= V230), G228 (≠ S231), R229 (= R232), H276 (= H279), A278 (≠ G281)
5j23A Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with 2'-phospho-adp-ribose (see paper)
52% identity, 86% coverage: 44:312/313 of query aligns to 40:308/318 of 5j23A
- active site: L94 (= L100), R228 (= R232), D252 (= D256), E257 (= E261), H275 (= H279)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4r,5r)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: V70 (= V76), L148 (≠ M152), G149 (= G153), R150 (= R154), I151 (= I155), T170 (≠ A174), R171 (= R175), P200 (= P204), S204 (≠ A208), T205 (= T209), R228 (= R232)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
44% identity, 89% coverage: 35:312/313 of query aligns to 36:321/334 of 5aovA
- active site: L100 (= L100), R241 (= R232), D265 (= D256), E270 (= E261), H288 (= H279)
- binding glyoxylic acid: M52 (≠ R52), L53 (≠ G53), L53 (≠ G53), Y74 (= Y74), A75 (≠ G75), V76 (= V76), G77 (= G77), R241 (= R232), H288 (= H279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V76), T104 (≠ V104), F158 (≠ M152), G159 (= G153), R160 (= R154), I161 (= I155), S180 (≠ A174), R181 (= R175), A211 (≠ I202), V212 (= V203), P213 (= P204), T218 (= T209), I239 (≠ V230), A240 (≠ S231), R241 (= R232), H288 (= H279), G290 (= G281)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
44% identity, 89% coverage: 35:312/313 of query aligns to 35:320/332 of 6biiA
- active site: L99 (= L100), R240 (= R232), D264 (= D256), E269 (= E261), H287 (= H279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (= V76), T103 (≠ V104), G156 (= G151), F157 (≠ M152), G158 (= G153), R159 (= R154), I160 (= I155), A179 (= A174), R180 (= R175), S181 (≠ H176), K183 (vs. gap), V211 (= V203), P212 (= P204), E216 (≠ A208), T217 (= T209), V238 (= V230), A239 (≠ S231), R240 (= R232), D264 (= D256), H287 (= H279), G289 (= G281)
2dbqA Crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with NADP (i41) (see paper)
39% identity, 98% coverage: 5:312/313 of query aligns to 4:321/333 of 2dbqA
- active site: L100 (= L100), R241 (= R232), D265 (= D256), E270 (= E261), H288 (= H279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V76), T104 (≠ V104), L158 (≠ M152), G159 (= G153), R160 (= R154), I161 (= I155), S180 (≠ A174), R181 (= R175), T182 (≠ H176), A211 (≠ I202), V212 (= V203), P213 (= P204), T218 (= T209), I239 (≠ V230), A240 (≠ S231), R241 (= R232), D265 (= D256), H288 (= H279), G290 (= G281)
O58320 Glyoxylate reductase; EC 1.1.1.26 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
39% identity, 98% coverage: 5:312/313 of query aligns to 4:321/334 of O58320
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
38% identity, 78% coverage: 67:310/313 of query aligns to 70:320/324 of 2gcgA
- active site: L103 (= L100), R241 (= R232), D265 (= D256), E270 (= E261), H289 (= H279)
- binding (2r)-2,3-dihydroxypropanoic acid: S78 (≠ G75), V79 (= V76), G80 (= G77), R241 (= R232), H289 (= H279)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (= V76), T107 (≠ V104), G156 (= G151), G158 (= G153), I160 (= I155), G180 (≠ A174), R181 (= R175), R184 (≠ H178), C212 (≠ V203), S213 (≠ P204), T218 (= T209), I239 (≠ V230), R241 (= R232), D265 (= D256), H289 (= H279), G291 (= G281)
Sites not aligning to the query:
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
38% identity, 78% coverage: 67:310/313 of query aligns to 74:324/328 of Q9UBQ7
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
36% identity, 91% coverage: 28:312/313 of query aligns to 25:310/526 of 3dc2A
Sites not aligning to the query:
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
36% identity, 91% coverage: 28:312/313 of query aligns to 26:311/525 of 3ddnB
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
36% identity, 88% coverage: 31:305/313 of query aligns to 28:304/304 of 1wwkA
- active site: S96 (≠ L100), R230 (= R232), D254 (= D256), E259 (= E261), H278 (= H279)
- binding nicotinamide-adenine-dinucleotide: V100 (= V104), G146 (= G151), F147 (≠ M152), G148 (= G153), R149 (= R154), I150 (= I155), Y168 (≠ F173), D169 (≠ A174), P170 (≠ R175), V201 (= V203), P202 (= P204), T207 (= T209), T228 (≠ V230), S229 (= S231), D254 (= D256), H278 (= H279), G280 (= G281)
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
31% identity, 83% coverage: 34:293/313 of query aligns to 37:297/533 of O43175
- T78 (≠ V76) binding
- R135 (≠ S133) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (= RI 154:155) binding
- D175 (≠ A174) binding
- T207 (≠ V203) binding
- CAR 234:236 (≠ VSR 230:232) binding
- D260 (= D256) binding
- V261 (= V257) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HHGS 279:282) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
7dkmA Phgdh covalently linked to oridonin (see paper)
31% identity, 83% coverage: 35:293/313 of query aligns to 34:293/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ V76), A102 (≠ V104), G148 (= G151), R151 (= R154), I152 (= I155), Y170 (≠ F173), D171 (≠ A174), P172 (≠ R175), I173 (≠ H176), H202 (≠ I202), T203 (≠ V203), P204 (= P204), T209 (= T209), C230 (≠ V230), A231 (≠ S231), R232 (= R232), H279 (= H279), G281 (= G281)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: E293 (≠ Q293)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
31% identity, 83% coverage: 35:293/313 of query aligns to 30:289/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G153), I148 (= I155), Y166 (≠ F173), D167 (≠ A174), P168 (≠ R175), I169 (≠ H176), I170 (≠ N177), H198 (≠ I202), T199 (≠ V203), L208 (≠ I212), R228 (= R232)
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
31% identity, 83% coverage: 35:293/313 of query aligns to 32:291/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (≠ L100), A100 (≠ V104), R149 (= R154), I150 (= I155), Y168 (≠ F173), D169 (≠ A174), P170 (≠ R175), I171 (≠ H176), H200 (≠ I202), T201 (≠ V203), P202 (= P204), T207 (= T209), C228 (≠ V230), A229 (≠ S231), R230 (= R232), H277 (= H279), G279 (= G281)
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
31% identity, 83% coverage: 35:293/313 of query aligns to 34:293/305 of 6plfA
Query Sequence
>WP_041936837.1 NCBI__GCF_000009265.1:WP_041936837.1
MPEVEILMAGAYPEWDMVDLEANYRIHRLWEATDRQELISRVGKDIRAIATRGELGASAE
LMAQLPKLEIVSCYGVGTDAIDLSYARANGIRVTNTPDVLTEDVADIALGLLLATARQIP
QADVLVRSGQWGSVAMPLVTRVSGKKVGIAGMGRIGKAIARRAAAFGCDISYFARHNHKD
VAYAYEPDLIALADWADFLIVIVPGGEATMKIINAEVLKALGPNGILINVSRGTTVDEEA
LIAALQDRTIQAAGLDVFLNEPKIDARFLTLGNVVLQPHHGSGTVETRKAMGQLVRDNLA
AHFAGSPLPTPVV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory