Comparing WP_041938828.1 NCBI__GCF_000058485.1:WP_041938828.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
5jlpA Crystal structure of mycobacterium avium serb2 in complex with serine at act domain
38% identity, 24% coverage: 176:246/293 of query aligns to 296:366/396 of 5jlpA
Sites not aligning to the query:
8a21A Crystal structure of phosphoserine phosphatase serb from mycobacterium avium in complex with phenylimidazole (see paper)
38% identity, 24% coverage: 176:246/293 of query aligns to 296:366/396 of 8a21A
Sites not aligning to the query:
8a1zA Crystal structure of phosphoserine phosphatase serb from mycobacterium avium in complex with 1-(2,4-dichlorophenyl)-3-hydroxyurea (see paper)
38% identity, 24% coverage: 176:246/293 of query aligns to 296:366/396 of 8a1zA
Sites not aligning to the query:
A0QJI1 Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 from Mycobacterium avium (strain 104) (see paper)
38% identity, 24% coverage: 176:246/293 of query aligns to 300:370/411 of A0QJI1
Sites not aligning to the query:
O53289 Phosphoserine phosphatase SerB2; PSP; PSPase; O-phosphoserine phosphohydrolase; Protein-serine/threonine phosphatase; EC 3.1.3.3; EC 3.1.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
29% identity, 47% coverage: 108:246/293 of query aligns to 229:368/409 of O53289
Sites not aligning to the query:
Q58989 Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see 3 papers)
34% identity, 29% coverage: 161:246/293 of query aligns to 109:194/211 of Q58989
Sites not aligning to the query:
1l7pA Substrate bound phosphoserine phosphatase complex structure (see paper)
34% identity, 29% coverage: 161:246/293 of query aligns to 106:191/208 of 1l7pA
Sites not aligning to the query:
1l7nA Transition state analogue of phosphoserine phosphatase (aluminum fluoride complex) (see paper)
34% identity, 29% coverage: 161:246/293 of query aligns to 107:192/209 of 1l7nA
Sites not aligning to the query:
1f5sA Crystal structure of phosphoserine phosphatase from methanococcus jannaschii (see paper)
34% identity, 29% coverage: 161:246/293 of query aligns to 108:193/210 of 1f5sA
Sites not aligning to the query:
1l7oA Crystal structure of phosphoserine phosphatase in apo form (see paper)
34% identity, 29% coverage: 161:246/293 of query aligns to 98:183/200 of 1l7oA
Sites not aligning to the query:
>WP_041938828.1 NCBI__GCF_000058485.1:WP_041938828.1
MRVRRRGVAETRQAAEAAAIAALKVAAEEVPRPPLDESAAAFFDVDNTMMAGASIFYFAR
GLAARDFFDSRDLLRFGWQHVTYRLRGHENPDGMRDARETALAFVAGRSVAEIVRYGEEI
YDERMAEQIYSGAHALAQQHLDAGQRVWLVTATPVELASVIARRLSLTGALGTVSEVTDG
TYTGHLVGGLLHGQAKAEAVQALAEREGLDLSRCWAYSDSINDLPMLSLVGHPVAINPDP
DLKTVAREREWPIKDFRTARKAVRIGIPAAAGAGALAGGVAAGMALRRRVASV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory