SitesBLAST
Comparing WP_041939957.1 NCBI__GCF_000058485.1:WP_041939957.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1uimA Crystal structure of threonine synthase from thermus thermophilus hb8, orthorhombic crystal form (see paper)
40% identity, 78% coverage: 67:399/425 of query aligns to 3:324/350 of 1uimA
- active site: K61 (= K125), T85 (= T149), P212 (= P277), G216 (= G282), Q218 (= Q284), A240 (≠ S313), T317 (= T390)
- binding pyridoxal-5'-phosphate: F60 (= F124), K61 (= K125), N87 (= N151), G187 (≠ A252), N188 (≠ S253), A189 (≠ G254), G190 (≠ S255), N191 (≠ L256), A240 (≠ S313), E287 (= E360), T317 (= T390), G318 (= G391)
3aeyA Apo form of threonine synthase from thermus thermophilus hb8 (see paper)
40% identity, 78% coverage: 67:399/425 of query aligns to 2:323/350 of 3aeyA
- active site: K60 (= K125), T84 (= T149), P211 (= P277), G215 (= G282), Q217 (= Q284), A239 (≠ S313), T316 (= T390)
- binding sulfate ion: K60 (= K125), K60 (= K125), G85 (= G150), N86 (= N151), T87 (≠ L152), T87 (≠ L152), S154 (≠ N219), R159 (≠ Y224), N187 (≠ S253), R228 (= R297), V230 (= V299), E231 (≠ D300), R232 (= R306), A239 (≠ S313)
3aexA Catalytic intermediate analogue of threonine synthase from thermus thermophilus hb8 (see paper)
40% identity, 78% coverage: 67:399/425 of query aligns to 3:324/351 of 3aexA
- active site: K61 (= K125), T85 (= T149), P212 (= P277), G216 (= G282), Q218 (= Q284), A240 (≠ S313), T317 (= T390)
- binding (3E)-4-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}-2-oxobut-3-enoic acid: K61 (= K125), S84 (= S148), T85 (= T149), N87 (= N151), T88 (≠ L152), V186 (≠ I251), G187 (≠ A252), N188 (≠ S253), A189 (≠ G254), G190 (≠ S255), N191 (≠ L256), A240 (≠ S313), I241 (≠ L314), E287 (= E360), T317 (= T390)
- binding phosphate ion: K61 (= K125), T88 (≠ L152), N154 (= N217), S155 (≠ N219), R160 (≠ Y224), N188 (≠ S253)
1v7cA Crystal structure of threonine synthase from thermus thermophilus hb8 in complex with a substrate analogue (see paper)
40% identity, 78% coverage: 67:399/425 of query aligns to 3:324/351 of 1v7cA
- active site: K61 (= K125), T85 (= T149), P212 (= P277), G216 (= G282), Q218 (= Q284), A240 (≠ S313), T317 (= T390)
- binding (2e)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]-5-phosphonopent-2-enoic acid: K61 (= K125), S84 (= S148), T85 (= T149), N87 (= N151), T88 (≠ L152), F134 (≠ Y197), N154 (= N217), S155 (≠ N219), R160 (≠ Y224), V186 (≠ I251), G187 (≠ A252), N188 (≠ S253), A189 (≠ G254), G190 (≠ S255), N191 (≠ L256), A240 (≠ S313), I241 (≠ L314), E287 (= E360), T317 (= T390)
6nmxA Threonine synthase from bacillus subtilis atcc 6633 with plp and appa (see paper)
34% identity, 81% coverage: 70:412/425 of query aligns to 7:333/350 of 6nmxA
- active site: K60 (= K125), T84 (= T149), E216 (≠ G282), S220 (≠ A286), A238 (≠ S313), T315 (= T390)
- binding (2E,3Z)-2-{[(Z)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4(1H)-ylidene}methyl]imino}-5-phosphonopent-3-enoic acid: K60 (= K125), S83 (= S148), T84 (= T149), N86 (= N151), T87 (≠ L152), F133 (≠ Y197), N153 (= N217), S154 (≠ N219), R159 (≠ Y224), V185 (≠ I251), G186 (≠ A252), N187 (≠ S253), A188 (≠ G254), G189 (≠ S255), N190 (≠ L256), A238 (≠ S313), I239 (≠ L314), E285 (= E360), T315 (= T390)
6cgqB Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
34% identity, 81% coverage: 70:412/425 of query aligns to 5:331/345 of 6cgqB
- active site: K58 (= K125), T82 (= T149), E214 (≠ G282), S218 (≠ A286), A236 (≠ S313), T313 (= T390)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-alanine: K58 (= K125), S81 (= S148), T82 (= T149), N84 (= N151), T85 (≠ L152), V183 (≠ I251), G184 (≠ A252), N185 (≠ S253), A186 (≠ G254), N188 (≠ L256), A236 (≠ S313), I237 (≠ L314), E283 (= E360), T313 (= T390)
- binding phosphate ion: K58 (= K125), T85 (≠ L152), N151 (= N217), S152 (≠ N219), R157 (≠ Y224), N185 (≠ S253)
2zsjA Crystal structure of threonine synthase from aquifex aeolicus vf5
37% identity, 77% coverage: 87:414/425 of query aligns to 22:341/350 of 2zsjA
- active site: K61 (= K125), T85 (= T149), Q218 (= Q284), A222 (≠ C288), A240 (≠ S313), T317 (= T390)
- binding pyridoxal-5'-phosphate: F60 (= F124), K61 (= K125), N87 (= N151), V186 (≠ I251), G187 (≠ A252), N188 (≠ S253), A189 (≠ G254), G190 (≠ S255), N191 (≠ L256), A240 (≠ S313), T317 (= T390), G318 (= G391)
6cgqA Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
34% identity, 81% coverage: 70:412/425 of query aligns to 3:323/339 of 6cgqA
- active site: K56 (= K125), T80 (= T149), E206 (≠ G282), S210 (≠ A286), A228 (≠ S313), T305 (= T390)
- binding pyridoxal-5'-phosphate: F55 (= F124), K56 (= K125), N82 (= N151), V175 (≠ I251), G176 (≠ A252), N177 (≠ S253), A178 (≠ G254), G179 (≠ S255), N180 (≠ L256), A228 (≠ S313), E275 (= E360), T305 (= T390), G306 (= G391)
A0R220 Threonine synthase; TS; EC 4.2.3.1 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
35% identity, 81% coverage: 67:412/425 of query aligns to 13:347/360 of A0R220
- K151 (≠ E206) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P9WG59 Threonine synthase; TS; EC 4.2.3.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
34% identity, 78% coverage: 67:398/425 of query aligns to 13:334/360 of P9WG59
- K69 (= K125) modified: N6-(pyridoxal phosphate)lysine
- N95 (= N151) binding
- K151 (≠ E206) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
- GNAGN 196:200 (≠ ASGSL 252:256) binding
- T326 (= T390) binding
2d1fA Structure of mycobacterium tuberculosis threonine synthase (see paper)
34% identity, 78% coverage: 67:398/425 of query aligns to 4:325/349 of 2d1fA
- active site: K60 (= K125), T84 (= T149), D209 (≠ E274), R213 (= R279), L215 (≠ F281), A240 (≠ S313), T317 (= T390)
- binding pyridoxal-5'-phosphate: F59 (= F124), K60 (= K125), N86 (= N151), V186 (≠ I251), G187 (≠ A252), N188 (≠ S253), A189 (≠ G254), G190 (≠ S255), N191 (≠ L256), A240 (≠ S313), T317 (= T390)
Q9S7B5 Threonine synthase 1, chloroplastic; Protein METHIONINE OVER-ACCUMULATOR 2; EC 4.2.3.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
29% identity, 73% coverage: 87:395/425 of query aligns to 164:477/526 of Q9S7B5
- N172 (≠ P95) binding
- L173 (= L96) binding
- K181 (≠ A104) binding in monomer B; binding in monomer A
- N187 (≠ K109) binding in monomer B
- L205 (≠ R127) mutation to R: In mto2-1; causes a strong decrease in the concentration of soluble threonine and over-accumulation of methionine.
2c2bA Crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine (see paper)
29% identity, 73% coverage: 87:395/425 of query aligns to 89:402/444 of 2c2bA
- binding pyridoxal-5'-phosphate: F127 (= F124), K128 (= K125), D159 (≠ N151), G259 (≠ I251), G260 (≠ A252), N261 (≠ S253), L262 (≠ G254), G263 (≠ S255), N264 (≠ L256), A321 (≠ S313), H369 (≠ A362), T397 (= T390)
- binding s-adenosylmethionine: S90 (= S88), F92 (≠ G90), N97 (≠ P95), L98 (= L96), W100 (≠ P98), W115 (≠ Y112), W115 (≠ Y112), Q246 (= Q238), F247 (≠ L239)
Sites not aligning to the query:
2c2gA Crystal structure of threonine synthase from arabidopsis thaliana in complex with its cofactor pyridoxal phosphate (see paper)
29% identity, 73% coverage: 87:395/425 of query aligns to 107:404/448 of 2c2gA
6zspAAA serine racemase bound to atp and malonate. (see paper)
24% identity, 62% coverage: 105:368/425 of query aligns to 33:281/320 of 6zspAAA
- active site: K53 (= K125), S74 (≠ T149), E200 (≠ Q284), A204 (≠ C288), D206 (≠ P290), G229 (≠ S313)
- binding adenosine-5'-triphosphate: K48 (≠ P120), T49 (= T121), Q79 (= Q154), Y111 (= Y186), E266 (≠ R353), R267 (≠ T354), K269 (≠ G356)
- binding magnesium ion: E200 (≠ Q284), A204 (≠ C288), D206 (≠ P290)
- binding malonate ion: K53 (= K125), S73 (= S148), S74 (≠ T149), N76 (= N151), H77 (≠ L152), R125 (≠ V200), G229 (≠ S313), S232 (≠ P319)
Sites not aligning to the query:
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
28% identity, 35% coverage: 91:238/425 of query aligns to 29:176/514 of P04968
- K62 (= K125) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N151) binding
Sites not aligning to the query:
- 188:192 binding
- 315 binding
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
28% identity, 35% coverage: 91:238/425 of query aligns to 25:172/494 of 1tdjA
Sites not aligning to the query:
- active site: 209, 213, 215, 237, 310, 311
- binding pyridoxal-5'-phosphate: 184, 185, 186, 187, 237, 282, 311, 312
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
27% identity, 71% coverage: 77:376/425 of query aligns to 3:293/319 of A4F2N8
- K53 (= K125) mutation to A: Loss of enzymatic activity.
3x43A Crystal structure of o-ureido-l-serine synthase (see paper)
36% identity, 29% coverage: 92:213/425 of query aligns to 11:136/316 of 3x43A
Sites not aligning to the query:
D2Z027 O-ureido-L-serine synthase; Cysteine synthase homolog DscD; O-acetylserine sulfhydrylase; EC 2.6.99.3; EC 2.5.1.47 from Streptomyces lavendulae (see paper)
36% identity, 29% coverage: 92:213/425 of query aligns to 12:137/324 of D2Z027
- K43 (= K125) modified: N6-(pyridoxal phosphate)lysine; mutation to A: Loss of catalytic activity, no longer binds N6-(pyridoxal phosphate)lysine.
- V74 (≠ L152) mutation to T: KM for OAS is 61 mM, KM for H(2)S is unchanged.
- Y97 (≠ L175) mutation to F: KM for OAS is unchanged, KM for H(2)S is 0.073 mM.; mutation to M: KM for OAS is 330 mM, KM for H(2)S is 0.084.
- S121 (≠ D199) mutation to A: KM for OAS is 140 mM, KM for H(2)S is 0.095 mM.; mutation to M: KM for OAS is 44 mM, KM for H(2)S is 0.20 mM.
Query Sequence
>WP_041939957.1 NCBI__GCF_000058485.1:WP_041939957.1
MTLAPERADTPALDVANPAVGLSCRHCGATYPLSPSHVCVECFAPLEISYDPDLLGRVTR
ESIERGPANLWRYVGLLPAGHDPARRVSLGAGWTPLRPAPRLAAELGMKTLYVKDDSANP
THSFKDRVVSVALSAARELGFTTVACASTGNLAQSVAAHAAGAGLRSVVLVPHDLEAGKT
VSTGVYGGTLVAIQGNYDDVNRLCSELAGEYEWAFVNVNVRPFYAEGSKTLGYEVAEQLG
WRLPEQVVVPIASGSLLTKVDKAFGELGKLGLVEPTPYRVFGAQAAGCNPVAAAFARGVD
TVAPVRPSTIAKSLSIGNPADGPYALDVARRTGGAITDVSDDEILEGMRLLARTEGIFGE
TAGGVTVANLRRLLREGLLDPAAETVIYNTGDGLKTLDPLVETGGPTATIKPSLRAFEAA
GLGDD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory