Comparing WP_042119961.1 NCBI__GCF_000092045.1:WP_042119961.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
34% identity, 83% coverage: 48:271/271 of query aligns to 50:295/296 of P68183
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
30% identity, 82% coverage: 49:271/271 of query aligns to 55:280/281 of P94530
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
28% identity, 44% coverage: 139:257/271 of query aligns to 358:487/490 of 4ki0F
Sites not aligning to the query:
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
28% identity, 44% coverage: 139:257/271 of query aligns to 373:502/514 of P02916
Sites not aligning to the query:
>WP_042119961.1 NCBI__GCF_000092045.1:WP_042119961.1
MKRKTLDRIGLLFAALVMISPVVLFFLWMISLSLKYEIDNGAYPPIFIPERFAWSNYVKV
FEENNFFLYLWNSLLVTGAATLLALVIGVPAGYGIARLKAEKSAMIIMIARMTPGLSFLI
PLFLLFQWLNLLGTLMPQIIIHLVVTVPIVVWIMIGYFETTPMELEEAASIDGATPWQVF
RLVALPIARPGIVVAFILSVIFSWNNFVFGIVLASRETRTLPVAVYNMLSFEQVSWGPLA
AAALIVTLPVLILTVFAQRQIVAGLTAGAVK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory