SitesBLAST
Comparing WP_042613067.1 NCBI__GCF_001431535.1:WP_042613067.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A0R066 Branched-chain-amino-acid aminotransferase; BCAT; EC 2.6.1.42 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see 2 papers)
57% identity, 100% coverage: 1:363/364 of query aligns to 1:367/368 of A0R066
- R101 (= R101) binding
- Y209 (= Y208) binding
- K299 (≠ Q295) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
- T314 (= T310) binding
3dtgA Structural analysis of mycobacterial branched chain aminotransferase- implications for inhibitor design
57% identity, 98% coverage: 6:363/364 of query aligns to 1:362/363 of 3dtgA
- active site: K199 (= K203)
- binding O-benzylhydroxylamine: F72 (= F77), Y171 (= Y175), Y204 (= Y208)
- binding pyridoxal-5'-phosphate: R96 (= R101), R189 (= R193), K199 (= K203), Y204 (= Y208), E235 (= E239), G238 (= G242), L263 (= L264), I266 (= I267), T267 (= T268), T309 (= T310)
3dtfA Structural analysis of mycobacterial branched chain aminotransferase- implications for inhibitor design (see paper)
57% identity, 98% coverage: 6:363/364 of query aligns to 1:362/363 of 3dtfA
3ht5A Crystal structure of ilve a branched chain amino acid transaminase from mycobacterium tuberculosis (see paper)
59% identity, 91% coverage: 34:364/364 of query aligns to 1:335/335 of 3ht5A
- active site: K171 (= K203)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R68 (= R101), K171 (= K203), Y176 (= Y208), E207 (= E239), G210 (= G242), M211 (= M243), N212 (= N244), L235 (= L264), G237 (= G266), I238 (= I267), T239 (= T268), T281 (= T310)
5u3fA Structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative (see paper)
58% identity, 90% coverage: 36:364/364 of query aligns to 2:326/326 of 5u3fA
- active site: K162 (= K203)
- binding (5-hydroxy-6-methyl-4-{[(3-oxo-2,3-dihydro-1,2-oxazol-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate: G45 (= G79), R67 (= R101), Y110 (= Y143), K162 (= K203), Y167 (= Y208), E198 (= E239), G201 (= G242), M202 (= M243), N203 (= N244), L226 (= L264), G228 (= G266), I229 (= I267), T230 (= T268), T272 (= T310)
7nyaA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor bay-069 (compound 36) (see paper)
42% identity, 94% coverage: 23:363/364 of query aligns to 13:363/364 of 7nyaA
- binding pyridoxal-5'-phosphate: R97 (= R101), R190 (= R193), K200 (= K203), Y205 (= Y208), E235 (= E239), T238 (≠ G242), M239 (= M243), L264 (= L264), G266 (= G266), V267 (≠ I267), T268 (= T268), G310 (= G309), T311 (= T310)
- binding 3-[4-chloranyl-3-(2-methylphenoxy)naphthalen-1-yl]-6-(trifluoromethyl)-5~{H}-pyrimidine-2,4-dione: F27 (= F31), Y68 (= Y72), F73 (= F77), Y139 (= Y143), G152 (= G156), V153 (= V157), Y171 (= Y175), Q212 (= Q215), Q222 (= Q225), T238 (≠ G242), A312 (= A311)
7ny9A Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor compound 38 (see paper)
42% identity, 94% coverage: 23:363/364 of query aligns to 13:363/364 of 7ny9A
- binding pyridoxal-5'-phosphate: R97 (= R101), R190 (= R193), K200 (= K203), Y205 (= Y208), E235 (= E239), T238 (≠ G242), M239 (= M243), N240 (= N244), L264 (= L264), G266 (= G266), V267 (≠ I267), T268 (= T268), T311 (= T310)
- binding 3-[2,6-bis(oxidanylidene)-4-(trifluoromethyl)-5~{H}-pyrimidin-1-yl]-~{N}-methyl-2-pyridin-2-yl-imidazo[1,2-a]pyridine-7-carboxamide: F27 (= F31), Y139 (= Y143), G152 (= G156), V153 (= V157), Y171 (= Y175), Q212 (= Q215), Q221 (≠ S224), Q222 (= Q225), V223 (= V226), T238 (≠ G242)
7ny2A Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor compound 35 (see paper)
42% identity, 94% coverage: 23:363/364 of query aligns to 13:363/364 of 7ny2A
- binding pyridoxal-5'-phosphate: R97 (= R101), K200 (= K203), Y205 (= Y208), E235 (= E239), T238 (≠ G242), M239 (= M243), L264 (= L264), G266 (= G266), V267 (≠ I267), T268 (= T268), T311 (= T310)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-2-(2-methylphenoxy)naphthalene-1-carbonitrile: F27 (= F31), Y139 (= Y143), G152 (= G156), V153 (= V157), Y171 (= Y175), Q212 (= Q215), Q222 (= Q225), A312 (= A311)
7nwmA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 12 (see paper)
42% identity, 94% coverage: 23:363/364 of query aligns to 14:364/365 of 7nwmA
- binding pyridoxal-5'-phosphate: R98 (= R101), R191 (= R193), K201 (= K203), Y206 (= Y208), E236 (= E239), T239 (≠ G242), M240 (= M243), L265 (= L264), G267 (= G266), V268 (≠ I267), T269 (= T268), G311 (= G309), T312 (= T310)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-5-methoxy-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F31), Y69 (= Y72), F74 (= F77), Y140 (= Y143), G153 (= G156), V154 (= V157), Y172 (= Y175), Q213 (= Q215), Q223 (= Q225), T239 (≠ G242), A313 (= A311)
7nweA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 10 (see paper)
42% identity, 94% coverage: 23:363/364 of query aligns to 14:364/365 of 7nweA
- binding pyridoxal-5'-phosphate: R98 (= R101), K201 (= K203), Y206 (= Y208), E236 (= E239), T239 (≠ G242), M240 (= M243), L265 (= L264), G267 (= G266), V268 (≠ I267), T269 (= T268), G311 (= G309), T312 (= T310)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-5-methyl-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F31), Y69 (= Y72), F74 (= F77), Y140 (= Y143), G153 (= G156), V154 (= V157), Y172 (= Y175), Q213 (= Q215), Q223 (= Q225), T239 (≠ G242), A313 (= A311)
7nwcA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 2 (see paper)
42% identity, 94% coverage: 23:363/364 of query aligns to 14:364/365 of 7nwcA
- binding pyridoxal-5'-phosphate: R98 (= R101), R191 (= R193), K201 (= K203), Y206 (= Y208), E236 (= E239), T239 (≠ G242), M240 (= M243), N241 (= N244), L265 (= L264), G267 (= G266), V268 (≠ I267), T269 (= T268), G311 (= G309), T312 (= T310)
- binding 3-(5-chloranyl-2,4-dimethoxy-phenyl)-6-(trifluoromethyl)-1H-pyrimidine-2,4-dione: F28 (= F31), Y172 (= Y175), Q223 (= Q225), T239 (≠ G242), A313 (= A311)
7nwbA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 1 (see paper)
42% identity, 94% coverage: 23:363/364 of query aligns to 14:364/365 of 7nwbA
- binding pyridoxal-5'-phosphate: R98 (= R101), R191 (= R193), K201 (= K203), Y206 (= Y208), E236 (= E239), T239 (≠ G242), M240 (= M243), L265 (= L264), G267 (= G266), V268 (≠ I267), T269 (= T268), G311 (= G309), T312 (= T310)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-5-fluoranyl-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F31), Y69 (= Y72), F74 (= F77), Y140 (= Y143), G153 (= G156), V154 (= V157), Y172 (= Y175), Q213 (= Q215), Q223 (= Q225), A313 (= A311)
7nwaA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and compound a (see paper)
42% identity, 94% coverage: 23:363/364 of query aligns to 14:364/365 of 7nwaA
- binding pyridoxal-5'-phosphate: R98 (= R101), K201 (= K203), Y206 (= Y208), E236 (= E239), T239 (≠ G242), N241 (= N244), L265 (= L264), G267 (= G266), V268 (≠ I267), T269 (= T268), T312 (= T310)
- binding 2-[[4-chloranyl-2,6-bis(fluoranyl)phenyl]methylamino]-7-oxidanylidene-5-propyl-4H-pyrazolo[1,5-a]pyrimidine-3-carbonitrile: R142 (= R145), G153 (= G156), V154 (= V157), Y172 (= Y175), F173 (= F176), V181 (= V183), Q223 (= Q225), V237 (≠ L240), T239 (≠ G242), M240 (= M243), G311 (= G309), A313 (= A311), C317 (≠ T315)
7nxoA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor compound 24(5-f) (see paper)
42% identity, 94% coverage: 23:363/364 of query aligns to 13:360/361 of 7nxoA
- binding pyridoxal-5'-phosphate: R97 (= R101), K197 (= K203), Y202 (= Y208), E232 (= E239), T235 (≠ G242), M236 (= M243), N237 (= N244), L261 (= L264), G263 (= G266), V264 (≠ I267), T265 (= T268), T308 (= T310)
- binding 4-[2,4-bis(oxidanylidene)-6-(phenylsulfonyl)-1H-pyrimidin-3-yl]-5-fluoranyl-2-(2-methylphenoxy)benzenecarbonitrile: F27 (= F31), Y68 (= Y72), F73 (= F77), G152 (= G156), V153 (= V157), Y171 (= Y175), F172 (= F176), Q209 (= Q215), Q218 (≠ S224), Q219 (= Q225), T235 (≠ G242)
7nxnA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor compound 21(5-f) (see paper)
42% identity, 94% coverage: 23:363/364 of query aligns to 14:361/362 of 7nxnA
- binding pyridoxal-5'-phosphate: R98 (= R101), R188 (= R193), K198 (= K203), Y203 (= Y208), E233 (= E239), T236 (≠ G242), M237 (= M243), N238 (= N244), L262 (= L264), G264 (= G266), V265 (≠ I267), T266 (= T268), T309 (= T310)
- binding 4-[6-[bis(fluoranyl)-phenyl-methyl]-2,4-bis(oxidanylidene)-1~{H}-pyrimidin-3-yl]-5-fluoranyl-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F31), Y69 (= Y72), F74 (= F77), G153 (= G156), V154 (= V157), Y172 (= Y175), Q210 (= Q215), Q219 (≠ S224), Q220 (= Q225), T236 (≠ G242)
7ntrA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and substrate mimic 3-phenylpropionate (see paper)
42% identity, 94% coverage: 23:363/364 of query aligns to 14:361/362 of 7ntrA
- binding hydrocinnamic acid: F28 (= F31), Y69 (= Y72), V154 (= V157), T236 (≠ G242), G308 (= G309), T309 (= T310), A310 (= A311)
- binding pyridoxal-5'-phosphate: R98 (= R101), R188 (= R193), K198 (= K203), Y203 (= Y208), E233 (= E239), T236 (≠ G242), M237 (= M243), L262 (= L264), G264 (= G266), V265 (≠ I267), T266 (= T268), G308 (= G309), T309 (= T310)
2abjA Crystal structure of human branched chain amino acid transaminase in a complex with an inhibitor, c16h10n2o4f3scl, and pyridoxal 5' phosphate. (see paper)
42% identity, 94% coverage: 23:363/364 of query aligns to 15:365/366 of 2abjA
- active site: K202 (= K203)
- binding n'-(5-chlorobenzofuran-2-carbonyl)-2-(trifluoromethyl)benzenesulfonohydrazide: F29 (= F31), F75 (= F77), Y141 (= Y143), Y173 (= Y175), K202 (= K203), Q224 (= Q225), T240 (≠ G242), M241 (= M243), G312 (= G309), A314 (= A311), C315 (≠ A312)
- binding pyridoxal-5'-phosphate: R99 (= R101), R192 (= R193), K202 (= K203), Y207 (= Y208), E237 (= E239), T240 (≠ G242), M241 (= M243), N242 (= N244), L266 (= L264), G268 (= G266), V269 (≠ I267), T270 (= T268), T313 (= T310)
2coiA Crystal structure of oxidized human cytosolic branched-chain aminotransferase complexed with gabapentin (see paper)
42% identity, 94% coverage: 23:363/364 of query aligns to 14:358/358 of 2coiA
- active site: K195 (= K203)
- binding [1-(aminomethyl)cyclohexyl]acetic acid: Y68 (= Y72), R141 (= R145), V153 (= V157), T233 (≠ G242), G305 (= G309), T306 (= T310), A307 (= A311)
- binding pyridoxal-5'-phosphate: R97 (= R101), R185 (= R193), K195 (= K203), Y200 (= Y208), E230 (= E239), T233 (≠ G242), L259 (= L264), G261 (= G266), V262 (≠ I267), T263 (= T268), T306 (= T310)
2cogA Crystal structure of oxidized human cytosolic branched-chain aminotransferase complexed with 4-methylvalerate (see paper)
42% identity, 94% coverage: 23:363/364 of query aligns to 14:358/358 of 2cogA
- active site: K195 (= K203)
- binding 4-methyl valeric acid: Y171 (= Y175), T233 (≠ G242), T306 (= T310), A307 (= A311)
- binding pyridoxal-5'-phosphate: R97 (= R101), K195 (= K203), Y200 (= Y208), E230 (= E239), T233 (≠ G242), L259 (= L264), G261 (= G266), V262 (≠ I267), T263 (= T268), T306 (= T310)
5cr5A X-ray crystal structure at 1.61a resolution of human mitochondrial branched chain aminotransferase (bcatm) complexed with a biphenyl pyrrolidine ether compound and an internal aldimine linked plp cofactor. (see paper)
40% identity, 92% coverage: 17:351/364 of query aligns to 4:348/358 of 5cr5A
- active site: K195 (= K203)
- binding 3-({(3R)-1-[(5-bromothiophen-2-yl)carbonyl]pyrrolidin-3-yl}oxy)-N-methyl-2'-[(methylsulfonyl)amino]biphenyl-4-carboxamide: F23 (= F31), F68 (= F77), Y166 (= Y175), V175 (= V183), Q217 (= Q225), V231 (≠ L240), G232 (= G241), T233 (≠ G242), M234 (= M243), G305 (= G309), A307 (= A311), C311 (≠ T315)
- binding pyridoxal-5'-phosphate: R92 (= R101), K195 (= K203), Y200 (= Y208), E230 (= E239), T233 (≠ G242), N235 (= N244), L259 (= L264), G261 (= G266), V262 (≠ I267), V263 (≠ T268), T306 (= T310)
Query Sequence
>WP_042613067.1 NCBI__GCF_001431535.1:WP_042613067.1
MSQSNISFDVTRSAHPRSADERAAILEKPGFGLHFTDHMVEVRWDKDTGWHNANVRPYGP
LLLDPAAAVLHYGQEIFEGIKAYRHADGSVWTFRPDANGRRLQRSAQRLALPELPVDIFV
ESLKQLVALDKDWVPSADESSLYFRPFMIGDEAFLGVRGAHKAGYYVIASPAGPYFAKGV
APVSIWLSTEYARAAKGGTGAAKCGGNYAASLLPQQKAQAQGCSQVLFLDPTEGKYLEEL
GGMNVFLVYKDGTLVTPQLSGSILEGITRESILQLARDRGMKVEERKVSIDEWKQGVASG
EITEVFACGTAAVVTPIGQLKGEGFEVGDINAPAGEVTLSLRKELTDIQYGRLPDRHGWL
VKLG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory