SitesBLAST
Comparing WP_042615137.1 NCBI__GCF_001431535.1:WP_042615137.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07913 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Escherichia coli (strain K12) (see paper)
63% identity, 99% coverage: 5:344/344 of query aligns to 1:341/341 of P07913
- C38 (= C42) mutation to D: Shows only 1% of wild-type catalytic activity. This mutant can be stimulated to the wild-type activity level after incubation with Zn(+).; mutation to S: Loss of catalytic activity. This mutant cannot be stimulated to the wild-type activity level after incubation with Zn(+).
5kiaA Crystal structure of l-threonine 3-dehydrogenase from burkholderia thailandensis
59% identity, 99% coverage: 5:343/344 of query aligns to 2:338/339 of 5kiaA
- active site: C37 (= C42), G38 (= G43), T39 (= T44), H42 (= H47), H61 (= H67), E62 (= E68), C91 (= C97), C94 (= C100), C97 (= C103), C105 (= C111), V109 (= V115), P147 (= P153), A151 (= A157), K333 (= K338)
- binding calcium ion: D146 (= D152), N150 (= N156), E288 (≠ K293)
- binding zinc ion: C91 (= C97), C94 (= C100), C97 (= C103), C105 (= C111)
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
45% identity, 99% coverage: 1:341/344 of query aligns to 1:345/348 of O58389
- C42 (= C42) binding
- T44 (= T44) mutation to A: Total loss of enzymatic activity.
- H67 (= H67) binding
- E68 (= E68) binding
- C97 (= C97) binding
- C100 (= C100) binding
- C103 (= C103) binding
- C111 (= C111) binding
- E152 (≠ D152) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ I179) binding
- E199 (≠ D199) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (= R204) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ LGI 265:267) binding
- IT 291:292 (≠ IY 289:290) binding
- R294 (= R292) mutation to A: 4000-fold decrease in catalytic efficiency.
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
45% identity, 99% coverage: 3:341/344 of query aligns to 1:343/346 of 2dfvA
- active site: C40 (= C42), G41 (= G43), T42 (= T44), H45 (= H47), H65 (= H67), E66 (= E68), C95 (= C97), C98 (= C100), C101 (= C103), C109 (= C111), K113 (≠ V115), P151 (= P153), A155 (= A157), K340 (= K338)
- binding nicotinamide-adenine-dinucleotide: G175 (= G177), P176 (= P178), L177 (≠ I179), E197 (≠ D199), P198 (≠ V200), R202 (= R204), F241 (≠ M242), S242 (= S243), A244 (≠ N245), L264 (= L265), G265 (= G266), L266 (≠ I267), I289 (= I289), T290 (≠ Y290)
- binding zinc ion: C95 (= C97), C101 (= C103), C109 (= C111)
Q5JI69 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
44% identity, 99% coverage: 1:341/344 of query aligns to 1:345/350 of Q5JI69
3gfbA L-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis (see paper)
44% identity, 99% coverage: 3:341/344 of query aligns to 1:343/347 of 3gfbA
- active site: C40 (= C42), G41 (= G43), T42 (= T44), H45 (= H47), H65 (= H67), E66 (= E68), C95 (= C97), C98 (= C100), C101 (= C103), C109 (= C111), K113 (≠ V115), P151 (= P153), A155 (= A157), K340 (= K338)
- binding nicotinamide-adenine-dinucleotide: G173 (= G175), G175 (= G177), P176 (= P178), L177 (≠ I179), S196 (≠ T198), E197 (≠ D199), P198 (≠ V200), R202 (= R204), F241 (≠ M242), S242 (= S243), A244 (≠ N245), L264 (= L265), G265 (= G266), L266 (≠ I267), I289 (= I289), T290 (≠ Y290)
2ejvA Crystal structure of threonine 3-dehydrogenase complexed with NAD+
43% identity, 98% coverage: 5:341/344 of query aligns to 1:339/343 of 2ejvA
- active site: C38 (= C42), G39 (= G43), T40 (= T44), H43 (= H47), H63 (= H67), E64 (= E68), C93 (= C97), C96 (= C100), C99 (= C103), C107 (= C111), Q111 (≠ V115), P149 (= P153), A153 (= A157), K336 (= K338)
- binding nicotinamide-adenine-dinucleotide: G172 (= G175), G174 (= G177), P175 (= P178), I176 (= I179), S195 (≠ T198), D196 (= D199), P197 (≠ V200), R201 (= R204), F238 (≠ M242), S239 (= S243), N241 (= N245), A244 (= A248), L261 (= L265), G262 (= G266), I263 (= I267)
- binding zinc ion: C38 (= C42), H63 (= H67), E64 (= E68), C96 (= C100), C99 (= C103), C107 (= C111)
2dq4A Crystal structure of threonine 3-dehydrogenase
43% identity, 98% coverage: 5:341/344 of query aligns to 1:339/343 of 2dq4A
- active site: C38 (= C42), G39 (= G43), T40 (= T44), H43 (= H47), H63 (= H67), E64 (= E68), C93 (= C97), C96 (= C100), C99 (= C103), C107 (= C111), Q111 (≠ V115), P149 (= P153), A153 (= A157), K336 (= K338)
- binding zinc ion: C38 (= C42), H63 (= H67), E64 (= E68), C93 (= C97), C96 (= C100), C107 (= C111)
Q5SKS4 L-threonine 3-dehydrogenase; TDH; EC 1.1.1.103 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
43% identity, 98% coverage: 5:341/344 of query aligns to 1:339/343 of Q5SKS4
4ej6A Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021
30% identity, 93% coverage: 3:323/344 of query aligns to 1:322/343 of 4ej6A
- active site: C40 (= C42), G41 (= G43), T42 (= T44), H45 (= H47), H61 (= H67), E62 (= E68), C91 (= C97), C94 (= C100), C97 (= C103), C105 (= C111), R109 (≠ V115), P147 (= P153), C151 (≠ A157)
- binding zinc ion: C91 (= C97), C94 (= C100), C97 (= C103), C105 (= C111)
Sites not aligning to the query:
4ejmA Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to NADP
30% identity, 93% coverage: 3:323/344 of query aligns to 1:322/342 of 4ejmA
- active site: C40 (= C42), G41 (= G43), T42 (= T44), H45 (= H47), H61 (= H67), E62 (= E68), C91 (= C97), C94 (= C100), C97 (= C103), C105 (= C111), R109 (≠ V115), P147 (= P153), C151 (≠ A157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G170 (= G175), G172 (= G177), V173 (≠ P178), I174 (= I179), T194 (≠ D199), R195 (≠ V200), Q196 (≠ N201), K199 (≠ R204), C240 (≠ M242), E245 (≠ R247), T246 (≠ A248), L263 (= L265), V265 (≠ I267), I291 (≠ G291)
- binding zinc ion: C91 (= C97), C94 (= C100), C97 (= C103), C105 (= C111)
Sites not aligning to the query:
5vm2A Crystal structure of eck1772, an oxidoreductase/dehydrogenase of unknown specificity involved in membrane biogenesis from escherichia coli
30% identity, 89% coverage: 24:329/344 of query aligns to 21:329/347 of 5vm2A
- active site: C39 (= C42), G40 (= G43), S41 (≠ T44), H44 (= H47), H65 (= H67), E66 (= E68), C95 (= C97), C98 (= C100), C101 (= C103), C109 (= C111), D113 (vs. gap), P153 (= P153), G157 (≠ A157)
- binding magnesium ion: H65 (= H67), E66 (= E68), E152 (≠ D152)
- binding zinc ion: C95 (= C97), C98 (= C100), C101 (= C103), C109 (= C111)
Sites not aligning to the query:
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
28% identity, 89% coverage: 29:335/344 of query aligns to 27:347/357 of 7y9pA
3meqA Crystal structure of alcohol dehydrogenase from brucella melitensis
30% identity, 99% coverage: 3:342/344 of query aligns to 1:339/341 of 3meqA
- active site: C40 (= C42), H41 (≠ G43), T42 (= T44), H45 (= H47), H63 (= H67), E64 (= E68), C94 (= C97), C97 (= C100), C100 (= C103), C108 (= C111), L112 (≠ V115), C150 (≠ P153), T154 (≠ A157), R335 (≠ K338)
- binding 1,4-dihydronicotinamide adenine dinucleotide: C40 (= C42), H41 (≠ G43), T42 (= T44), H45 (= H47), C150 (≠ P153), T154 (≠ A157), G176 (= G177), G177 (≠ P178), L178 (≠ I179), D197 (= D199), I198 (≠ V200), K202 (≠ R204), T241 (≠ S243), A242 (≠ G244), V243 (vs. gap), S244 (≠ N245), A247 (= A248), N264 (≠ L265), G265 (= G266), L266 (≠ I267), I289 (= I289), V290 (≠ Y290)
- binding zinc ion: C40 (= C42), H63 (= H67), C94 (= C97), C97 (= C100), C100 (= C103), C108 (= C111), C150 (≠ P153)
3s2fE Crystal structure of furx nadh:furfural
31% identity, 99% coverage: 5:344/344 of query aligns to 3:339/340 of 3s2fE
- active site: C40 (= C42), H41 (≠ G43), T42 (= T44), H45 (= H47), H63 (= H67), E64 (= E68), C94 (= C97), C97 (= C100), C100 (= C103), C108 (= C111), Q112 (≠ V115), C150 (≠ P153), T154 (≠ A157), R333 (≠ K338)
- binding furfural: T42 (= T44), W51 (= W54), H63 (= H67), W89 (≠ G93), C150 (≠ P153), I287 (= I289)
- binding nicotinamide-adenine-dinucleotide: C40 (= C42), H41 (≠ G43), T42 (= T44), C150 (≠ P153), T154 (≠ A157), G174 (= G175), G176 (= G177), G177 (≠ P178), L178 (≠ I179), D197 (= D199), I198 (≠ V200), K202 (≠ R204), T239 (≠ M242), A240 (≠ S243), V241 (≠ G244), N262 (≠ L265), G263 (= G266), L264 (≠ I267), I287 (= I289), V288 (≠ Y290), R333 (≠ K338)
- binding zinc ion: C40 (= C42), H63 (= H67), C94 (= C97), C97 (= C100), C100 (= C103), C108 (= C111), C150 (≠ P153)
3s2fA Crystal structure of furx nadh:furfural
31% identity, 99% coverage: 5:344/344 of query aligns to 3:339/340 of 3s2fA
- active site: C40 (= C42), H41 (≠ G43), T42 (= T44), H45 (= H47), H63 (= H67), E64 (= E68), C94 (= C97), C97 (= C100), C100 (= C103), C108 (= C111), Q112 (≠ V115), C150 (≠ P153), T154 (≠ A157), R333 (≠ K338)
- binding phosphorylisopropane: T42 (= T44), H63 (= H67), W89 (≠ G93), I287 (= I289)
- binding zinc ion: C40 (= C42), H63 (= H67), E64 (= E68), C94 (= C97), C97 (= C100), C100 (= C103), C108 (= C111), C150 (≠ P153)
3s2eE Crystal structure of furx nadh complex 1
31% identity, 99% coverage: 5:344/344 of query aligns to 3:339/340 of 3s2eE
- active site: C40 (= C42), H41 (≠ G43), T42 (= T44), H45 (= H47), H63 (= H67), E64 (= E68), C94 (= C97), C97 (= C100), C100 (= C103), C108 (= C111), Q112 (≠ V115), C150 (≠ P153), T154 (≠ A157), R333 (≠ K338)
- binding nicotinamide-adenine-dinucleotide: C40 (= C42), H41 (≠ G43), T42 (= T44), C150 (≠ P153), T154 (≠ A157), G176 (= G177), G177 (≠ P178), L178 (≠ I179), D197 (= D199), I198 (≠ V200), K202 (≠ R204), T239 (≠ M242), A240 (≠ S243), V241 (≠ G244), S242 (≠ N245), A245 (= A248), N262 (≠ L265), G263 (= G266), L264 (≠ I267), I287 (= I289), V288 (≠ Y290)
- binding zinc ion: C40 (= C42), H63 (= H67), C94 (= C97), C97 (= C100), C100 (= C103), C108 (= C111), C150 (≠ P153)
3s2eA Crystal structure of furx nadh complex 1
31% identity, 99% coverage: 5:344/344 of query aligns to 3:339/340 of 3s2eA
- active site: C40 (= C42), H41 (≠ G43), T42 (= T44), H45 (= H47), H63 (= H67), E64 (= E68), C94 (= C97), C97 (= C100), C100 (= C103), C108 (= C111), Q112 (≠ V115), C150 (≠ P153), T154 (≠ A157), R333 (≠ K338)
- binding zinc ion: C40 (= C42), H63 (= H67), E64 (= E68), C94 (= C97), C97 (= C100), C100 (= C103), C108 (= C111), C150 (≠ P153)
6z42A The low resolution structure of a zinc-dependent alcohol dehydrogenase from halomonas elongata.
31% identity, 99% coverage: 3:342/344 of query aligns to 2:334/336 of 6z42A
- active site: C41 (= C42), T43 (= T44), H46 (= H47), H64 (= H67), C148 (≠ P153)
- binding zinc ion: C41 (= C42), H64 (= H67), E65 (= E68), C95 (= C97), C98 (= C100), C101 (= C103), C109 (= C111), C148 (≠ P153)
4ilkA Crystal structure of short chain alcohol dehydrogenase (rspb) from e. Coli cft073 (efi target efi-506413) complexed with cofactor nadh
27% identity, 97% coverage: 12:343/344 of query aligns to 10:337/337 of 4ilkA
- active site: C40 (= C42), G41 (= G43), S42 (≠ T44), H45 (= H47), H59 (= H67), E60 (= E68), C89 (= C97), C92 (= C100), C95 (= C103), C103 (= C111), A107 (≠ V115), P145 (= P153), A149 (= A157), K332 (= K338)
- binding manganese (ii) ion: C40 (= C42), H59 (= H67), E60 (= E68), E144 (≠ D152)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G168 (= G175), G170 (= G177), P171 (= P178), I172 (= I179), D193 (= D199), R194 (≠ V200), R198 (= R204), N213 (≠ V219), A235 (≠ M242), A236 (≠ S243), C237 (≠ G244), I241 (≠ A248), M258 (≠ L265), F260 (≠ I267)
- binding zinc ion: C89 (= C97), C92 (= C100), C95 (= C103), C103 (= C111)
Query Sequence
>WP_042615137.1 NCBI__GCF_001431535.1:WP_042615137.1
MAQTMKALVKREAAKGIWLEEVPVPVPGPNEVLIKLEKTAICGTDLHIYLWDEWSQRTIT
PGLTIGHEFVGRVAALGSAVTGYEVGQRVSAEGHIVCGHCRNCRGGRQHLCPNTVGIGVN
VNGAFAEYMVMPATNLWPIPDQIPSELAAFFDPYGNAAHCALEFNVIGEDVLITGAGPIG
IIAAGICKHIGARNVVVTDVNDFRLKLAADMGATRVVNVANQSLKDVMKELHMEGFDVGL
EMSGNPRAFNDMLDCMYHGGKIAMLGIMPRGAGCDWDKIIFKGLTVQGIYGRKMYETWYK
MTQLVLSGFPLGKVMTHQLPIDDFQKGFDLMEEGKAGKVVLSWN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory