Comparing WP_043529939.1 NCBI__GCF_000759345.1:WP_043529939.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
52% identity, 97% coverage: 2:277/285 of query aligns to 7:278/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
52% identity, 97% coverage: 2:277/285 of query aligns to 7:278/290 of 8gsrA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
41% identity, 90% coverage: 24:279/285 of query aligns to 34:277/279 of 6v77B
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
35% identity, 86% coverage: 35:278/285 of query aligns to 33:277/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
35% identity, 86% coverage: 35:278/285 of query aligns to 33:277/280 of 6j5xA
O06724 Oxaloacetate tautomerase YisK; Oxaloacetate decarboxylase YisK; EC 5.3.2.2; EC 4.1.1.112 from Bacillus subtilis (strain 168) (see paper)
38% identity, 79% coverage: 53:277/285 of query aligns to 77:300/301 of O06724
Sites not aligning to the query:
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
38% identity, 79% coverage: 53:277/285 of query aligns to 77:300/303 of 8skyB
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
38% identity, 79% coverage: 53:277/285 of query aligns to 78:301/303 of 8sutA
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
41% identity, 72% coverage: 74:277/285 of query aligns to 72:274/277 of 6iymA
Q8R0F8 Oxaloacetate tautomerase FAHD1, mitochondrial; Acylpyruvase FAHD1; Acylpyruvate hydrolase; ApH; Fumarylacetoacetate hydrolase domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; ODx; EC 5.3.2.2; EC 3.7.1.5; EC 4.1.1.112 from Mus musculus (Mouse) (see paper)
36% identity, 73% coverage: 73:281/285 of query aligns to 17:220/221 of Q8R0F8
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
36% identity, 72% coverage: 73:277/285 of query aligns to 14:213/216 of 6sbiA
1gttA Crystal structure of hpce (see paper)
38% identity, 62% coverage: 71:248/285 of query aligns to 223:392/421 of 1gttA
Q6P587 Oxaloacetate tautomerase FAHD1, mitochondrial; Acylpyruvase FAHD1; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; ODx; YisK-like protein; EC 5.3.2.2; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 4 papers)
34% identity, 72% coverage: 73:277/285 of query aligns to 17:216/221 of Q6P587
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
34% identity, 72% coverage: 73:277/285 of query aligns to 15:214/218 of 6fogA
Sites not aligning to the query:
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
35% identity, 86% coverage: 39:282/285 of query aligns to 29:264/265 of 3r6oA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
35% identity, 73% coverage: 72:278/285 of query aligns to 63:248/252 of 3qdfA
P76004 Oxaloacetate tautomerase YcgM; EC 5.3.2.2 from Escherichia coli (strain K12)
35% identity, 70% coverage: 70:269/285 of query aligns to 16:211/219 of P76004
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
35% identity, 73% coverage: 70:278/285 of query aligns to 23:231/233 of 6j5yA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
37% identity, 62% coverage: 72:247/285 of query aligns to 63:243/269 of 4dbhA
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
33% identity, 63% coverage: 70:248/285 of query aligns to 15:197/224 of 3v77A
>WP_043529939.1 NCBI__GCF_000759345.1:WP_043529939.1
MKLLRFGPVGQEKPGMLDANGTLRDLSAHIDDLRGEALSQERLAELARIDPASLPEVPAG
ARIGPCVAGVGKFICIGLNYSDHAAETGAEVPAEPVIFNKWTSAICGPNDDVIIPRGSQK
TDWEVELGVIIGKGGRYIDESNAMAHVAGFCVVNDVSEREYQLERCGSWDKGKGCDTFGP
LGPWLVTPDEIDDPHSLGMWLEVDGKRYQDGSTDTMVYQVPFLISYLSRFMSLQPGDVIS
TGTPPGVGMGQKPQVYLKPGQRMRLGIDGLGEQEQRVINDEERER
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory