Comparing WP_043531902.1 NCBI__GCF_000759345.1:WP_043531902.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
4ymwC Crystal structure of an amino acid abc transporter with histidines (see paper)
37% identity, 92% coverage: 9:213/222 of query aligns to 9:213/214 of 4ymwC
4ymtC Crystal structure of an amino acid abc transporter complex with arginines (see paper)
37% identity, 92% coverage: 9:213/222 of query aligns to 9:213/215 of 4ymtC
>WP_043531902.1 NCBI__GCF_000759345.1:WP_043531902.1
MLEFIEFGIEWLPRLLQGVPVTLLLWIIAITLGFFLGLMLCWARVYGNRLFYWISTAYVE
LFRGTPMLVQMFFIYLGLPHVGIVFDAFTAAVIAITLNSAAYQAEYFRGSVLSVPKGQLV
AARACGMSQWQAIRHIMLPQALRRVIPQWSNEAIIELKFTSIAYTIGVVEITAIASDIGS
RTFDFFQVFLWAGIIYLVLTSTVASLLGLLERRTYVPGVTNI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory