SitesBLAST
Comparing WP_043743043.1 NCBI__GCF_000009985.1:WP_043743043.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8NBZ7 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UGD; UXS-1; hUXS; hUXS1; EC 4.1.1.35 from Homo sapiens (Human) (see 4 papers)
58% identity, 98% coverage: 4:315/317 of query aligns to 87:395/420 of Q8NBZ7
- G98 (= G15) binding
- F99 (= F16) binding
- V100 (≠ L17) binding
- D119 (= D36) binding
- N120 (= N37) binding
- F122 (= F39) binding
- T123 (= T40) binding
- G124 (= G41) binding
- D144 (= D61) binding
- V145 (= V62) binding
- L149 (= L66) binding
- Y150 (= Y67) binding
- L159 (= L76) binding
- S161 (≠ C78) binding
- K177 (= K94) binding
- T178 (= T95) binding
- N185 (= N102) binding
- G188 (= G105) binding
- K191 (= K108) binding
- R192 (= R109) binding
- A200 (≠ S117) binding
- E204 (= E121) mutation to A: Reduced UDP-glucuronic acid decarboxylase activity.
- Y231 (= Y148) active site, Proton acceptor; binding ; mutation to F: Abolished UDP-glucuronic acid decarboxylase activity.
- K235 (= K152) binding
- R236 (= R153) mutation to H: Strongly reduced UDP-glucuronic acid decarboxylase activity, caused by a local unfolding of the active site that allows for a rotation of the dimer interface, leading to the formation of a homohexamer.
- Y245 (= Y162) binding
- Q248 (= Q165) binding
- E249 (≠ H166) binding
- T261 (= T178) binding
- H267 (= H184) binding
- R272 (= R189) binding
- R361 (= R280) mutation to Q: Strongly reduced UDP-glucuronic acid decarboxylase activity.
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
2b69A Crystal structure of human udp-glucoronic acid decarboxylase
58% identity, 98% coverage: 5:315/317 of query aligns to 1:308/312 of 2b69A
- active site: T115 (= T119), S116 (= S120), E117 (= E121), Y144 (= Y148), K148 (= K152), R185 (= R189)
- binding nicotinamide-adenine-dinucleotide: G8 (= G12), G11 (= G15), F12 (= F16), V13 (≠ L17), D32 (= D36), N33 (= N37), T36 (= T40), G37 (= G41), D57 (= D61), V58 (= V62), L72 (= L76), A73 (= A77), S74 (≠ C78), A76 (= A80), T91 (= T95), T115 (= T119), Y144 (= Y148), K148 (= K152), I171 (= I175), N173 (= N177), R185 (= R189)
- binding uridine-5'-diphosphate: P61 (= P65), L62 (= L66), Y63 (= Y67), P78 (= P82), N98 (= N102), G101 (= G105), L102 (= L106), K104 (= K108), R105 (= R109), Y158 (= Y162), N173 (= N177), R185 (= R189), V186 (= V190), N189 (= N193), T201 (= T205), Y203 (= Y207), Q208 (= Q212), R210 (= R214), I244 (= I250), D270 (= D276)
Q6GMI9 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UXS-1; EC 4.1.1.35 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
58% identity, 98% coverage: 4:315/317 of query aligns to 85:393/418 of Q6GMI9
- R234 (= R153) mutation to H: In Man o' war (mow) mutant; characterized by severe craniofacial defects. Fishes show defective organization and morphogenesis of chondrocytes, perichondrium and bone.
4lk3B Crystal structure of human udp-xylose synthase r236a substitution (see paper)
50% identity, 98% coverage: 5:315/317 of query aligns to 1:270/274 of 4lk3B
- active site: T112 (= T119), S113 (= S120), E114 (= E121), K119 (= K152), R156 (= R189)
- binding nicotinamide-adenine-dinucleotide: G8 (= G12), G11 (= G15), F12 (= F16), V13 (≠ L17), D32 (= D36), N33 (= N37), T36 (= T40), G37 (= G41), D57 (= D61), V58 (= V62), L72 (= L76), A73 (= A77), S74 (≠ C78), P75 (= P79), T88 (= T95), A110 (≠ S117), T112 (= T119), K119 (= K152), I142 (= I175), H151 (= H184)
- binding uridine-5'-diphosphate: R156 (= R189), V157 (= V190), N160 (= N193), T172 (= T205), Y174 (= Y207), Q179 (= Q212), R181 (= R214), I215 (= I250)
- binding uridine-5'-diphosphate-glucuronic acid: P61 (= P65), L62 (= L66), Y63 (= Y67), I83 (≠ V90), K87 (= K94), N95 (= N102), G98 (= G105), L99 (= L106), K101 (= K108), Y129 (= Y162), E133 (≠ H166)
4lk3C Crystal structure of human udp-xylose synthase r236a substitution (see paper)
49% identity, 98% coverage: 5:315/317 of query aligns to 1:267/271 of 4lk3C
- active site: T110 (= T119), S111 (= S120), E112 (= E121), K117 (= K152), R154 (= R189)
- binding nicotinamide-adenine-dinucleotide: G8 (= G12), G11 (= G15), F12 (= F16), V13 (≠ L17), D32 (= D36), N33 (= N37), T36 (= T40), G37 (= G41), D57 (= D61), V58 (= V62), L72 (= L76), A73 (= A77), S74 (≠ C78), P75 (= P79), T86 (= T95), K117 (= K152), I140 (= I175), H149 (= H184)
- binding pyrophosphate 2-: R154 (= R189), V155 (= V190)
- binding uridine-5'-diphosphate-glucuronic acid: P61 (= P65), L62 (= L66), Y63 (= Y67), N93 (= N102), G96 (= G105), L97 (= L106), K99 (= K108), R100 (= R109), Y127 (= Y162), E131 (≠ H166)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
35% identity, 96% coverage: 8:312/317 of query aligns to 3:305/309 of 4zrnA
- active site: T117 (≠ S118), G119 (≠ S120), A120 (≠ E121), Y143 (= Y148), K147 (= K152), Y181 (vs. gap), G185 (≠ R189)
- binding nicotinamide-adenine-dinucleotide: G7 (= G12), G10 (= G15), F11 (= F16), I12 (≠ L17), D31 (= D36), N32 (= N37), S34 (≠ F39), S35 (≠ T40), G36 (= G41), S51 (vs. gap), I52 (vs. gap), L73 (= L76), A74 (= A77), A75 (≠ C78), T92 (= T95), S115 (≠ Q116), S116 (= S117), Y143 (= Y148), K147 (= K152), Y170 (≠ I175), V173 (≠ T178)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S118), G119 (≠ S120), A120 (≠ E121), Y143 (= Y148), N172 (= N177), G185 (≠ R189), V186 (= V190), H201 (≠ T205), F203 (≠ Y207), Y208 (≠ Q212), R210 (= R214), V244 (≠ I250), R267 (≠ P273), D270 (= D276)
4m55E Crystal structure of human udp-xylose synthase r236h substitution (see paper)
36% identity, 74% coverage: 7:242/317 of query aligns to 1:156/164 of 4m55E
- active site: T105 (= T119)
- binding nicotinamide-adenine-dinucleotide: G6 (= G12), G9 (= G15), F10 (= F16), V11 (≠ L17), D30 (= D36), N31 (= N37), F32 (= F38), T34 (= T40), G35 (= G41), D55 (= D61), V56 (= V62), S72 (≠ C78), P73 (= P79), T81 (= T95), T105 (= T119), T131 (= T178)
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
31% identity, 97% coverage: 7:312/317 of query aligns to 2:311/321 of 6zllA
- active site: T126 (= T119), S127 (= S120), S128 (≠ E121), Y149 (= Y148), K153 (= K152)
- binding nicotinamide-adenine-dinucleotide: G7 (= G12), G10 (= G15), F11 (= F16), I12 (≠ L17), D32 (= D36), H33 (≠ N37), F34 (= F38), I35 (≠ F39), K43 (vs. gap), D62 (= D61), I63 (≠ V62), L81 (= L76), A82 (= A77), A83 (≠ C78), I124 (≠ S117), T126 (= T119), Y149 (= Y148), K153 (= K152), Y176 (≠ I175), V179 (≠ T178), R185 (≠ H184), M188 (≠ R189)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (= P79), V87 (≠ S81), R88 (≠ P82), T126 (= T119), S127 (= S120), Y149 (= Y148), T178 (≠ N177), R185 (≠ H184), A189 (≠ V190), R192 (≠ N193), T204 (= T205), F206 (≠ Y207), Q211 (= Q212), R213 (= R214), I250 (= I250), E276 (≠ D276)
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
31% identity, 97% coverage: 7:312/317 of query aligns to 2:311/314 of 6zldA
- active site: T126 (= T119), S127 (= S120), S128 (≠ E121), Y149 (= Y148), K153 (= K152)
- binding nicotinamide-adenine-dinucleotide: G7 (= G12), G10 (= G15), F11 (= F16), I12 (≠ L17), D32 (= D36), H33 (≠ N37), F34 (= F38), I35 (≠ F39), K43 (vs. gap), D62 (= D61), I63 (≠ V62), L81 (= L76), A82 (= A77), A83 (≠ C78), I124 (≠ S117), T126 (= T119), K153 (= K152), Y176 (≠ I175), T178 (≠ N177), R185 (≠ H184), M188 (≠ R189)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (= P79), R88 (≠ P82), T126 (= T119), S127 (= S120), S128 (≠ E121), Y149 (= Y148), F177 (= F176), T178 (≠ N177), R185 (≠ H184), M188 (≠ R189), A189 (≠ V190), R192 (≠ N193), T204 (= T205), F206 (≠ Y207), Q211 (= Q212), R213 (= R214), I250 (= I250), E276 (≠ D276)
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
31% identity, 97% coverage: 7:312/317 of query aligns to 2:311/314 of 6zl6A
- active site: T126 (= T119), S127 (= S120), S128 (≠ E121), Y149 (= Y148), K153 (= K152)
- binding nicotinamide-adenine-dinucleotide: G7 (= G12), G10 (= G15), F11 (= F16), I12 (≠ L17), D32 (= D36), H33 (≠ N37), F34 (= F38), I35 (≠ F39), K43 (vs. gap), D62 (= D61), I63 (≠ V62), L81 (= L76), A82 (= A77), A83 (≠ C78), I124 (≠ S117), T126 (= T119), K153 (= K152), Y176 (≠ I175), T178 (≠ N177), V179 (≠ T178), R185 (≠ H184), M188 (≠ R189)
- binding uridine-5'-diphosphate: T178 (≠ N177), A189 (≠ V190), R192 (≠ N193), T204 (= T205), F206 (≠ Y207), Q211 (= Q212), R213 (= R214), I250 (= I250), E276 (≠ D276)
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
30% identity, 97% coverage: 7:312/317 of query aligns to 2:311/314 of 6zljA
- active site: T126 (= T119), S127 (= S120), S128 (≠ E121), F149 (≠ Y148), K153 (= K152)
- binding nicotinamide-adenine-dinucleotide: G7 (= G12), G10 (= G15), F11 (= F16), I12 (≠ L17), D32 (= D36), H33 (≠ N37), F34 (= F38), I35 (≠ F39), K43 (vs. gap), D62 (= D61), I63 (≠ V62), L81 (= L76), A82 (= A77), A83 (≠ C78), I124 (≠ S117), T126 (= T119), K153 (= K152), Y176 (≠ I175), T178 (≠ N177), V179 (≠ T178), R185 (≠ H184), M188 (≠ R189)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (= P79), R88 (≠ P82), T126 (= T119), S127 (= S120), S128 (≠ E121), F149 (≠ Y148), F177 (= F176), T178 (≠ N177), R185 (≠ H184), M188 (≠ R189), A189 (≠ V190), R192 (≠ N193), T204 (= T205), F206 (≠ Y207), Q211 (= Q212), R213 (= R214), I250 (= I250), E276 (≠ D276)
8vr2B Crystal structure of the pcryo_0617 oxidoreductase/decarboxylase from psychrobacter cryohalolentis k5 in the presence of NAD and udp
31% identity, 98% coverage: 6:315/317 of query aligns to 8:315/321 of 8vr2B
- binding nicotinamide-adenine-dinucleotide: G14 (= G12), G17 (= G15), F18 (= F16), I19 (≠ L17), D37 (= D36), N38 (= N37), E40 (≠ F39), R41 (≠ T40), N61 (≠ D61), V62 (= V62), A81 (= A77), A82 (≠ C78), A83 (≠ P79), F124 (≠ S117), K154 (= K152), P177 (≠ I175), N179 (= N177)
- binding uridine-5'-diphosphate: R147 (= R145), G189 (≠ D187), A190 (≠ G188), M194 (≠ F194), Y205 (≠ T205), I206 (≠ L206), F207 (≠ Y207), R214 (= R214), I251 (= I250)
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
31% identity, 97% coverage: 7:314/317 of query aligns to 2:311/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: G7 (= G12), G10 (= G15), F11 (= F16), I12 (≠ L17), D31 (= D36), N32 (= N37), T35 (= T40), G36 (= G41), D56 (= D61), I57 (vs. gap), L77 (= L76), A78 (= A77), A79 (≠ C78), I81 (≠ A80), V96 (≠ T95), T119 (≠ Q116), Y146 (= Y148), K150 (= K152), P173 (≠ I175), A174 (≠ F176), N175 (= N177), V176 (≠ T178)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A80), R84 (≠ I83), S121 (= S118), G123 (≠ S120), Y146 (= Y148), A174 (≠ F176), N175 (= N177), A187 (≠ G188), G188 (≠ R189), V189 (= V190), F193 (= F194), R204 (≠ T205), V205 (≠ L206), F206 (≠ Y207), R213 (= R214), D248 (≠ I250), R271 (≠ P273)
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
31% identity, 97% coverage: 7:314/317 of query aligns to 2:311/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: G7 (= G12), G10 (= G15), F11 (= F16), I12 (≠ L17), D31 (= D36), N32 (= N37), T35 (= T40), G36 (= G41), D56 (= D61), I57 (vs. gap), L77 (= L76), A78 (= A77), A79 (≠ C78), I81 (≠ A80), T119 (≠ Q116), Y146 (= Y148), K150 (= K152), P173 (≠ I175), N175 (= N177), V176 (≠ T178)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ A80), R84 (≠ I83), S121 (= S118), G123 (≠ S120), S124 (≠ E121), Y146 (= Y148), A174 (≠ F176), N175 (= N177), G188 (≠ R189), V189 (= V190), F193 (= F194), R204 (≠ T205), V205 (≠ L206), F206 (≠ Y207), N211 (≠ Q212), R213 (= R214), D248 (≠ I250), R271 (≠ P273)
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
31% identity, 97% coverage: 7:312/317 of query aligns to 2:309/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ A80), R84 (≠ I83), S121 (= S118), G123 (≠ S120), Y146 (= Y148), A174 (≠ F176), N175 (= N177), A187 (≠ G188), G188 (≠ R189), V189 (= V190), F193 (= F194), R204 (≠ T205), F206 (≠ Y207), N211 (≠ Q212), R213 (= R214), D248 (≠ I250), R271 (≠ P273)
- binding nicotinamide-adenine-dinucleotide: G7 (= G12), G10 (= G15), F11 (= F16), I12 (≠ L17), D31 (= D36), N32 (= N37), A34 (≠ F39), T35 (= T40), G36 (= G41), D56 (= D61), I57 (vs. gap), L77 (= L76), A78 (= A77), A79 (≠ C78), I81 (≠ A80), T119 (≠ Q116), Y146 (= Y148), K150 (= K152), P173 (≠ I175), A174 (≠ F176), V176 (≠ T178)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A80), R84 (≠ I83), S121 (= S118), G123 (≠ S120), Y146 (= Y148), A174 (≠ F176), N175 (= N177), A187 (≠ G188), G188 (≠ R189), V189 (= V190), F193 (= F194), R204 (≠ T205), F206 (≠ Y207), N211 (≠ Q212), R213 (= R214), D248 (≠ I250), R271 (≠ P273)
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
32% identity, 97% coverage: 7:312/317 of query aligns to 2:310/313 of 6bwlA
- active site: T122 (= T119), C123 (≠ S120), M124 (≠ E121), Y147 (= Y148), K151 (= K152)
- binding nicotinamide-adenine-dinucleotide: G7 (= G12), G10 (= G15), F11 (= F16), I12 (≠ L17), D31 (= D36), N32 (= N37), L33 (≠ F38), N35 (≠ T40), S36 (≠ G41), D57 (= D61), I58 (≠ V62), L79 (= L76), A80 (= A77), A81 (≠ C78), I83 (≠ A80), M120 (≠ S117), K151 (= K152), N176 (= N177), T177 (= T178)
- binding uridine-5'-diphosphate: N176 (= N177), G189 (≠ R189), V190 (= V190), N205 (≠ T205), I206 (≠ L206), Y207 (= Y207), Q212 (= Q212), R214 (= R214), I250 (= I250), E275 (≠ D276)
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
32% identity, 90% coverage: 6:289/317 of query aligns to 2:280/308 of 6wj9B
- active site: A119 (≠ T119), A120 (≠ S120), A121 (≠ E121), F144 (≠ R145), K148 (≠ R153)
- binding nicotinamide-adenine-dinucleotide: G8 (= G12), G11 (= G15), F12 (= F16), I13 (≠ L17), D32 (= D36), D33 (≠ N37), S35 (≠ F39), T36 (= T40), G37 (= G41), D55 (= D61), A56 (≠ V62), L75 (= L76), A76 (= A77), A77 (≠ C78), S94 (≠ T95), A117 (≠ S117), A119 (≠ T119), F144 (≠ R145), K148 (≠ R153), F171 (≠ I175), F172 (= F176), I174 (≠ T178)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (≠ P82), N173 (= N177), G187 (≠ R189), V188 (= V190), F192 (= F194), T203 (= T205), L204 (= L206), F205 (≠ Y207), R212 (= R214), L248 (≠ I250), R271 (= R280), D274 (= D283)
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
32% identity, 90% coverage: 6:289/317 of query aligns to 1:279/307 of 6wjaA
- active site: A118 (≠ T119), A119 (≠ S120), A120 (≠ E121), F143 (≠ R145), K147 (≠ R153)
- binding nicotinamide-adenine-dinucleotide: G7 (= G12), G10 (= G15), F11 (= F16), I12 (≠ L17), D31 (= D36), D32 (≠ N37), S34 (≠ F39), T35 (= T40), G36 (= G41), A55 (≠ V62), L74 (= L76), A75 (= A77), A76 (≠ C78), S93 (≠ T95), F143 (≠ R145), K147 (≠ R153), F170 (≠ I175), F171 (= F176), I173 (≠ T178)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (≠ P82), A120 (≠ E121), N172 (= N177), G186 (≠ R189), V187 (= V190), F191 (= F194), T202 (= T205), F204 (≠ Y207), R211 (= R214), L247 (≠ I250), R270 (= R280), D273 (= D283)
1z7eD Crystal structure of full length arna (see paper)
29% identity, 97% coverage: 5:311/317 of query aligns to 303:637/644 of 1z7eD
- binding adenosine-5'-triphosphate: G313 (= G15), F314 (= F16), I315 (≠ L17), D335 (≠ F39), I336 (≠ T40), D356 (= D61), I357 (≠ V62), V378 (≠ A77), R498 (= R189)
- binding uridine-5'-diphosphate-glucuronic acid: A381 (= A80), P383 (= P82), Y386 (= Y85), E422 (= E121), Y451 (= Y148), F479 (= F176), N480 (= N177), R498 (= R189), A499 (≠ V190), K514 (≠ T205), L515 (= L206), I516 (≠ Y207), R523 (= R214), I562 (= I250), Y597 (≠ K270), Y601 (≠ A274), R607 (= R280)
Sites not aligning to the query:
P77398 Bifunctional polymyxin resistance protein ArnA; Polymyxin resistance protein PmrI; EC 2.1.2.13; EC 1.1.1.305 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 97% coverage: 5:311/317 of query aligns to 315:649/660 of P77398
- S433 (= S120) mutation to A: 40-fold lower specific activity.; mutation to T: No activity.
- E434 (= E121) mutation to A: 100-fold lower specific activity.; mutation to Q: No activity.
- R619 (= R280) mutation R->E,Y: No activity.; mutation to M: 400-fold lower activity.
Sites not aligning to the query:
- 102 N→A: No formyltransferase activity.
- 104 H→A: 25-fold lower formyltransferase activity.; H→K: Less than 1% residual formyltransferase activity.
- 140 mutation D->A,N: Less than 1% residual formyltransferase activity.
Query Sequence
>WP_043743043.1 NCBI__GCF_000009985.1:WP_043743043.1
MKYDRKRVLVTGGAGFLGSHLCERLLAEGCDVLCVDNFFTGTKANIAHLLDNPYFEMMRH
DVTFPLYVEVDEIFNLACPASPIHYQRDPVQTTKTSVHGAINMLGLAKRVGAKIFQSSTS
EVYGDPDVHPQPESYRGNVNPIGPRACYDEGKRCAETLFFDYWRQHSLRIKVARIFNTYG
PRMHPDDGRVVSNFIMQALQGQPITLYGDGSQTRSFCYVDDLIEGFIRLMNSPDDITGPI
NLGNPREMTIRQLAELVVRMTGAKSEIIYKPLPADDPMQRKPDITQAKAVLNDWEPKVAL
EQGLEKTIAYFKGKIAE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory