SitesBLAST
Comparing WP_043743064.1 NCBI__GCF_000009985.1:WP_043743064.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
44% identity, 97% coverage: 5:323/328 of query aligns to 2:321/334 of 5aovA
- active site: L100 (= L104), R241 (= R243), D265 (= D267), E270 (= E272), H288 (= H290)
- binding glyoxylic acid: M52 (≠ T55), L53 (≠ V56), L53 (≠ V56), Y74 (≠ F78), A75 (≠ G79), V76 (≠ T80), G77 (= G81), R241 (= R243), H288 (= H290)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ T80), T104 (= T108), F158 (≠ M158), G159 (= G159), R160 (= R160), I161 (= I161), S180 (≠ N180), R181 (= R181), A211 (≠ H213), V212 (≠ C214), P213 (= P215), T218 (= T220), I239 (≠ T241), A240 (= A242), R241 (= R243), H288 (= H290), G290 (= G292)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
44% identity, 96% coverage: 5:320/328 of query aligns to 1:317/332 of 6biiA
- active site: L99 (= L104), R240 (= R243), D264 (= D267), E269 (= E272), H287 (= H290)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (≠ T80), T103 (= T108), G156 (= G157), F157 (≠ M158), G158 (= G159), R159 (= R160), I160 (= I161), A179 (≠ N180), R180 (= R181), S181 (≠ K182), K183 (≠ H185), V211 (≠ C214), P212 (= P215), E216 (≠ A219), T217 (= T220), V238 (≠ T241), A239 (= A242), R240 (= R243), D264 (= D267), H287 (= H290), G289 (= G292)
2dbqA Crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with NADP (i41) (see paper)
44% identity, 96% coverage: 5:320/328 of query aligns to 2:318/333 of 2dbqA
- active site: L100 (= L104), R241 (= R243), D265 (= D267), E270 (= E272), H288 (= H290)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ T80), T104 (= T108), L158 (≠ M158), G159 (= G159), R160 (= R160), I161 (= I161), S180 (≠ N180), R181 (= R181), T182 (≠ K182), A211 (≠ H213), V212 (≠ C214), P213 (= P215), T218 (= T220), I239 (≠ T241), A240 (= A242), R241 (= R243), D265 (= D267), H288 (= H290), G290 (= G292)
O58320 Glyoxylate reductase; EC 1.1.1.26 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
44% identity, 96% coverage: 5:320/328 of query aligns to 2:318/334 of O58320
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
43% identity, 77% coverage: 65:317/328 of query aligns to 61:306/313 of Q65CJ7
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
43% identity, 77% coverage: 65:317/328 of query aligns to 59:304/311 of 3bazA
- active site: L98 (= L104), R230 (= R243), A251 (= A264), D254 (= D267), E259 (= E272), H277 (= H290)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (≠ T80), G149 (= G157), L150 (≠ M158), G151 (= G159), R152 (= R160), I153 (= I161), S172 (≠ N180), R173 (= R181), S174 (≠ K182), C201 (= C214), P202 (= P215), T207 (= T220), I228 (≠ T241), G229 (≠ A242), R230 (= R243), D254 (= D267), H277 (= H290), G279 (= G292)
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
36% identity, 90% coverage: 8:302/328 of query aligns to 5:301/324 of 2gcgA
- active site: L103 (= L104), R241 (= R243), D265 (= D267), E270 (= E272), H289 (= H290)
- binding (2r)-2,3-dihydroxypropanoic acid: L55 (≠ V56), S78 (≠ G79), V79 (≠ T80), G80 (= G81), R241 (= R243), H289 (= H290)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (≠ T80), T107 (= T108), G156 (= G157), G158 (= G159), I160 (= I161), G180 (≠ R181), R181 (≠ K182), R184 (≠ H185), C212 (= C214), S213 (≠ P215), T218 (= T220), I239 (≠ T241), R241 (= R243), D265 (= D267), H289 (= H290), G291 (= G292)
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
36% identity, 90% coverage: 8:302/328 of query aligns to 9:305/328 of Q9UBQ7
5v6qB Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and malonate (see paper)
39% identity, 96% coverage: 4:317/328 of query aligns to 2:305/319 of 5v6qB
- active site: L96 (= L104), R230 (= R243), D254 (= D267), E259 (= E272), H277 (= H290)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V72 (≠ T80), V100 (≠ T108), F148 (≠ I156), L150 (≠ M158), G151 (= G159), R152 (= R160), I153 (= I161), T172 (≠ N180), R173 (= R181), V201 (≠ C214), P202 (= P215), S206 (≠ A219), T207 (= T220), V228 (≠ T241), G229 (≠ A242), R230 (= R243), H277 (= H290), A279 (≠ G292)
5v7nA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and 2-keto-d-gluconic acid (see paper)
39% identity, 96% coverage: 4:317/328 of query aligns to 1:304/319 of 5v7nA
- active site: L95 (= L104), R229 (= R243), D253 (= D267), E258 (= E272), H276 (= H290)
- binding 2-keto-D-gluconic acid: G70 (= G79), V71 (≠ T80), G72 (= G81), R229 (= R243), H276 (= H290), S279 (= S293), R285 (= R299)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V71 (≠ T80), V99 (≠ T108), L149 (≠ M158), G150 (= G159), R151 (= R160), I152 (= I161), T171 (≠ N180), R172 (= R181), V200 (≠ C214), P201 (= P215), S205 (≠ A219), T206 (= T220), V227 (≠ T241), G228 (≠ A242), R229 (= R243), H276 (= H290), A278 (≠ G292)
5j23A Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with 2'-phospho-adp-ribose (see paper)
39% identity, 95% coverage: 5:317/328 of query aligns to 1:303/318 of 5j23A
- active site: L94 (= L104), R228 (= R243), D252 (= D267), E257 (= E272), H275 (= H290)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4r,5r)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: V70 (≠ T80), L148 (≠ M158), G149 (= G159), R150 (= R160), I151 (= I161), T170 (≠ N180), R171 (= R181), P200 (= P215), S204 (≠ A219), T205 (= T220), R228 (= R243)
5v7gA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
39% identity, 95% coverage: 5:317/328 of query aligns to 1:303/317 of 5v7gA
- active site: L94 (= L104), R228 (= R243), D252 (= D267), E257 (= E272), H275 (= H290)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V70 (≠ T80), V98 (≠ T108), F146 (≠ I156), L148 (≠ M158), G149 (= G159), R150 (= R160), I151 (= I161), T170 (≠ N180), R171 (= R181), V199 (≠ C214), P200 (= P215), S204 (≠ A219), T205 (= T220), V226 (≠ T241), G227 (≠ A242), R228 (= R243), H275 (= H290), A277 (≠ G292)
- binding oxalate ion: G69 (= G79), V70 (≠ T80), G71 (= G81), R228 (= R243), H275 (= H290)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
40% identity, 82% coverage: 42:311/328 of query aligns to 35:303/304 of 1wwkA
- active site: S96 (≠ L104), R230 (= R243), D254 (= D267), E259 (= E272), H278 (= H290)
- binding nicotinamide-adenine-dinucleotide: V100 (≠ T108), G146 (= G157), F147 (≠ M158), G148 (= G159), R149 (= R160), I150 (= I161), Y168 (≠ H179), D169 (≠ N180), P170 (≠ R181), V201 (≠ C214), P202 (= P215), T207 (= T220), T228 (= T241), S229 (≠ A242), D254 (= D267), H278 (= H290), G280 (= G292)
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
36% identity, 87% coverage: 32:316/328 of query aligns to 27:305/305 of 6plfA
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
36% identity, 85% coverage: 32:310/328 of query aligns to 25:297/297 of 6rj3A
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
36% identity, 85% coverage: 32:310/328 of query aligns to 23:295/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G159), I148 (= I161), Y166 (= Y178), D167 (≠ H179), P168 (= P186), I169 (≠ D187), I170 (= I188), H198 (= H213), T199 (≠ C214), L208 (= L223), R228 (= R243)
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
36% identity, 85% coverage: 32:310/328 of query aligns to 26:298/301 of 6rj5A
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
36% identity, 85% coverage: 32:310/328 of query aligns to 26:298/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ I156), G147 (= G157), L148 (≠ M158), G149 (= G159), R150 (= R160), I151 (= I161), G152 (= G162), D170 (≠ H179), H201 (= H213), T202 (≠ C214), P203 (= P215)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
36% identity, 85% coverage: 32:310/328 of query aligns to 26:298/302 of 6rihA
7dkmA Phgdh covalently linked to oridonin (see paper)
36% identity, 85% coverage: 32:310/328 of query aligns to 27:299/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (= T80), A102 (≠ T108), G148 (= G157), R151 (= R160), I152 (= I161), Y170 (= Y178), D171 (≠ H179), P172 (= P186), I173 (≠ D187), H202 (= H213), T203 (≠ C214), P204 (= P215), T209 (= T220), C230 (≠ T241), A231 (= A242), R232 (= R243), H279 (= H290), G281 (= G292)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: E293 (= E304)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18
Query Sequence
>WP_043743064.1 NCBI__GCF_000009985.1:WP_043743064.1
MPSKKPVVVVSRKLPDVIETRMMELFDTRLNVDDHPMTKTELIEAVKIADVLVPTVTDRI
DAGILSQAGPNLKLVANFGTGVDHIDLATARQRGITVTNTPGVLTEDTADMAMALIMSVP
RRIAEGERLIRSGDWKGWSPTFMLGHRIWGKRLGIIGMGRIGQAVARRAKAFGMSIHYHN
RKRVHPDIETELEATYWESLDQMLARMDVVTVHCPHTPATFHLLSARRLELLPKHAYVVN
TARGEIVDENALTRMLIRGDLAGAGLDVFEHEPAVNPKLLALDNVVLLPHLGSATIEGRV
DMGEKVLVNIKTFADGHQPPDRVLASMF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory