Comparing WP_043743213.1 NCBI__GCF_000009985.1:WP_043743213.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
51% identity, 72% coverage: 5:840/1157 of query aligns to 6:832/841 of 8g3hA
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
32% identity, 99% coverage: 7:1157/1157 of query aligns to 11:1192/1227 of P13009
Sites not aligning to the query:
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
32% identity, 99% coverage: 8:1157/1157 of query aligns to 26:1230/1265 of Q99707
8sseA Methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8
49% identity, 45% coverage: 632:1157/1157 of query aligns to 4:506/507 of 8sseA
4cczA Crystal structure of human 5-methyltetrahydrofolate-homocysteine methyltransferase, the homocysteine and folate binding domains
32% identity, 52% coverage: 8:611/1157 of query aligns to 10:607/611 of 4cczA
5vooA Methionine synthase folate-binding domain with methyltetrahydrofolate from thermus thermophilus hb8 (see paper)
49% identity, 24% coverage: 343:615/1157 of query aligns to 5:277/282 of 5vooA
3bulA E. Coli i690c/g743c meth c-terminal fragment (649-1227) (see paper)
32% identity, 46% coverage: 626:1157/1157 of query aligns to 5:542/577 of 3bulA
3ivaA Structure of the b12-dependent methionine synthase (meth) c-teminal half with adohcy bound (see paper)
32% identity, 46% coverage: 626:1157/1157 of query aligns to 5:542/576 of 3ivaA
1q8jA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex) (see paper)
29% identity, 49% coverage: 8:577/1157 of query aligns to 11:538/559 of 1q8jA
3bofA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ and homocysteine (see paper)
29% identity, 49% coverage: 8:577/1157 of query aligns to 11:538/560 of 3bofA
3k13C Structure of the pterin-binding domain metr of 5- methyltetrahydrofolate-homocysteine methyltransferase from bacteroides thetaiotaomicron
33% identity, 24% coverage: 340:613/1157 of query aligns to 4:281/287 of 3k13C
1bmtA How a protein binds b12: a 3.O angstrom x-ray structure of the b12- binding domains of methionine synthase (see paper)
38% identity, 19% coverage: 626:850/1157 of query aligns to 5:231/246 of 1bmtA
2yckX Methyltransferase bound with tetrahydrofolate (see paper)
34% identity, 21% coverage: 335:576/1157 of query aligns to 6:238/272 of 2yckX
2ycjA Methyltransferase bound with methyltetrahydrofolate (see paper)
34% identity, 21% coverage: 335:576/1157 of query aligns to 5:237/271 of 2ycjA
2yciX Methyltransferase native (see paper)
34% identity, 21% coverage: 335:576/1157 of query aligns to 5:237/271 of 2yciX
7xcnP Crystal structure of the mttb-mttc complex at 2.7 a resolution (see paper)
33% identity, 17% coverage: 623:820/1157 of query aligns to 3:200/215 of 7xcnP
Sites not aligning to the query:
6bdyA Crystal structure of the meth reactivation domain bound to sinefungin (see paper)
33% identity, 18% coverage: 952:1157/1157 of query aligns to 80:292/326 of 6bdyA
Sites not aligning to the query:
1mskA Methionine synthase (activation domain) (see paper)
33% identity, 18% coverage: 952:1157/1157 of query aligns to 80:292/327 of 1mskA
Sites not aligning to the query:
2i2xB Crystal structure of methanol:cobalamin methyltransferase complex mtabc from methanosarcina barkeri (see paper)
29% identity, 16% coverage: 634:820/1157 of query aligns to 43:228/258 of 2i2xB
Sites not aligning to the query:
Q46EH4 Methanol--corrinoid protein; Methanol:corrinoid methyltransferase 1 subunit of 27 kDa; MT1 subunit 27 kDa from Methanosarcina barkeri (strain Fusaro / DSM 804) (see paper)
29% identity, 16% coverage: 634:820/1157 of query aligns to 43:228/258 of Q46EH4
Sites not aligning to the query:
>WP_043743213.1 NCBI__GCF_000009985.1:WP_043743213.1
MTNILDHLSRHVLLCDGGTGALVQAMNLSVEKDFQGLENCTEILVKSRPDVIRGIHARYF
EAGADMVEADTFGASPITLAEFGIAERAHELNQAAIELAWEAAEQFKGDGRTRFVLGAIG
PGTKLPSLGHIGYDELEAAYVIQAAGQIAGGVSAFLVETCQDPLQIKAAVNGCKIANAAA
GTDVPVFVQVTVETTGTLLVGADIAAAATVVQSLGVPLMGLNCAAGPQEMGEHFKWLIDN
WTGFVSIQPNAGLPELVDGQTRYPLLPAELAVWHERFVSAGANLLGGCCGTTPPHISATN
EMLKRIGNGYRPNPVKRSVHWVPSVASLYTQVPLRQENAFLSIGERCNANGSKKFRDLQD
AEDWDGITAIAREQVKEGSHTLDVCTAFVGRNEVADMTEVVSRLRGAVTTPLVIDSTELP
VLEAGLKLYGGKAILNSINFENGEKDAADRLVLARKFGAAVVALTIDEDGMAKDAAAKLR
IAKRLYDFAVTKHGLPASDLLFDPLTFTICTGNEDDRKLAVETLDAIEMITREMPECGIV
LGLSNVSFGLKPAARQVLNSVFIDHAIKRGMTGAIVHVSKIVPLHTLPEEEVKAAEDLIY
DRDPQALSRYIALFGDRKAAEIKKERPAKAEDRLKQRIIDGDRTGLEDDLAQVMEEGWKP
LDIINTLLLDGMKVVGELFGSGKMQLPFVLQSAETMKASVAFLEPHMEKADGQQKATMVL
ATVKGDVHDIGKNLVDIILTNNGYKVINIGIKQPVAEIIKAAKEHKADAVGMSGLLVKST
VIMRENLEEMTNAGLDVPVLLGGAALTRKYVEEDCSKAYGSGRVAYARDAFDGLDLMAKV
ADGSFDAHVAAKAASPHRPGSPSRTLGEAAQPATRPVDWDEINLRRAELHKDVPAPVPPF
WGARVIESAPLQNLIPFLNETMLYQFHWGYRKQGKSIEEFKAWAHKEIRPVAMDMLKRCA
KEEILRPQAVYGYWKAASDNDSVVLFAEDGTTEVARFPFPRQAKDGGLCIADFFRPVSDP
VRDVIGLQVVTMGKRATEVAQDWFKADKYQDYLYLHGLSVEMAEAMAEYVHKRIRSELGF
AAEDAADMDRLLKQNYRGSRFSFGYPACPRIEDQTQLLSLLGAERIGVTLSEEFQLEPEQ
STSAIVTVHPQAKYFSV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory