SitesBLAST
Comparing WP_043743254.1 NCBI__GCF_000009985.1:WP_043743254.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1phpA Structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms (see paper)
50% identity, 94% coverage: 3:392/415 of query aligns to 4:391/394 of 1phpA
- active site: R36 (= R35), K197 (= K195), G351 (= G352), G374 (= G375)
- binding adenosine-5'-diphosphate: G195 (= G193), K201 (= K199), G219 (= G217), G220 (= G218), L237 (= L235), N316 (= N314), P318 (= P316), G320 (= G318), V321 (≠ A319), E323 (= E321), G350 (= G351), D352 (= D353), S353 (≠ T354)
P18912 Phosphoglycerate kinase; EC 2.7.2.3 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
50% identity, 94% coverage: 3:392/415 of query aligns to 4:391/394 of P18912
P40924 Phosphoglycerate kinase; EC 2.7.2.3 from Bacillus subtilis (strain 168) (see paper)
49% identity, 94% coverage: 3:393/415 of query aligns to 4:392/394 of P40924
- S183 (≠ E181) modified: Phosphoserine
- T299 (≠ S297) modified: Phosphothreonine
1vpeA Crystallographic analysis of phosphoglycerate kinase from the hyperthermophilic bacterium thermotoga maritima (see paper)
48% identity, 94% coverage: 4:395/415 of query aligns to 4:396/398 of 1vpeA
- active site: R35 (= R35), K196 (= K195), G353 (= G352), G376 (= G375)
- binding phosphoaminophosphonic acid-adenylate ester: G194 (= G193), A195 (= A194), K196 (= K195), K200 (= K199), G218 (= G217), A219 (≠ G218), N316 (= N314), P318 (= P316), G320 (= G318), V321 (≠ A319), E323 (= E321), G352 (= G351), G353 (= G352), D354 (= D353), S355 (≠ T354)
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
48% identity, 94% coverage: 4:392/415 of query aligns to 5:394/654 of P36204
- R36 (= R35) binding
- R118 (= R116) binding
- R151 (= R149) binding
4feyA An x-ray structure of a putative phosphogylcerate kinase with bound adp from francisella tularensis subsp. Tularensis schu s4
48% identity, 94% coverage: 2:392/415 of query aligns to 3:386/392 of 4feyA
- active site: R36 (= R35), K193 (= K195), G346 (= G352), G369 (= G375)
- binding adenosine-5'-diphosphate: G191 (= G193), S192 (≠ A194), K197 (= K199), G215 (= G217), G316 (= G318), V317 (≠ A319), E319 (= E321), D347 (= D353)
P07378 Phosphoglycerate kinase, glycosomal; Phosphoglycerate kinase C; EC 2.7.2.3 from Trypanosoma brucei brucei (see 2 papers)
40% identity, 98% coverage: 3:407/415 of query aligns to 7:431/440 of P07378
4ng4B Structure of phosphoglycerate kinase (cbu_1782) from coxiella burnetii (see paper)
45% identity, 94% coverage: 2:392/415 of query aligns to 2:384/389 of 4ng4B
- active site: R35 (= R35), K191 (= K195), G344 (= G352), G367 (= G375)
- binding adenosine-5'-diphosphate: G189 (= G193), K195 (= K199), G213 (= G217), I286 (= I290), N310 (= N314), G311 (= G315), P312 (= P316), V315 (≠ A319), E317 (= E321), G343 (= G351), D345 (= D353), T346 (= T354)
- binding magnesium ion: D288 (= D292), G314 (= G318), F321 (= F325), S322 (≠ D326), T325 (= T329)
16pkA Phosphoglycerate kinase from trypanosoma brucei bisubstrate analog (see paper)
41% identity, 94% coverage: 3:392/415 of query aligns to 3:412/415 of 16pkA
- active site: R35 (= R35), K215 (= K195), G372 (= G352), G395 (= G375)
- binding 1,1,5,5-tetrafluorophosphopentylphosphonic acid adenylate ester: G213 (= G193), A214 (= A194), K219 (= K199), A238 (≠ G218), Y241 (≠ N221), L311 (= L291), P336 (= P316), G338 (= G318), V339 (≠ A319), E341 (= E321), G393 (≠ A373), G394 (= G374), G395 (= G375)
13pkA Ternary complex of phosphoglycerate kinase from trypanosoma brucei (see paper)
41% identity, 94% coverage: 3:392/415 of query aligns to 3:412/415 of 13pkA
- active site: R35 (= R35), K215 (= K195), G372 (= G352), G395 (= G375)
- binding adenosine-5'-diphosphate: G213 (= G193), A214 (= A194), K219 (= K199), L311 (= L291), P336 (= P316), G338 (= G318), V339 (≠ A319), E341 (= E321), G371 (= G351), D373 (= D353), S374 (≠ T354)
P0A799 Phosphoglycerate kinase; EC 2.7.2.3 from Escherichia coli (strain K12) (see 3 papers)
48% identity, 93% coverage: 8:393/415 of query aligns to 9:382/387 of P0A799
- K84 (≠ A81) modified: N6-acetyllysine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1zmrA Crystal structure of the e. Coli phosphoglycerate kinase (see paper)
48% identity, 93% coverage: 8:393/415 of query aligns to 8:381/386 of 1zmrA
P09041 Phosphoglycerate kinase 2; Phosphoglycerate kinase, testis specific; EC 2.7.2.3 from Mus musculus (Mouse) (see paper)
44% identity, 94% coverage: 4:392/415 of query aligns to 8:414/417 of P09041
2wzcA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp, 3pg and aluminium tetrafluoride (see paper)
45% identity, 94% coverage: 4:392/415 of query aligns to 6:402/405 of 2wzcA
- active site: R37 (= R35), K204 (= K195), G362 (= G352), G385 (= G375)
- binding adenosine-5'-diphosphate: G202 (= G193), A203 (= A194), K204 (= K195), K208 (= K199), G226 (= G217), G227 (= G218), N325 (= N314), P327 (= P316), G329 (= G318), V330 (≠ A319), E332 (= E321), G361 (= G351), D363 (= D353), T364 (= T354)
- binding tetrafluoroaluminate ion: R37 (= R35), K204 (= K195), K208 (= K199), G361 (= G351), G362 (= G352), G384 (= G374)
2wzbA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp, 3pg and magnesium trifluoride (see paper)
45% identity, 94% coverage: 4:392/415 of query aligns to 6:402/405 of 2wzbA
- active site: R37 (= R35), K204 (= K195), G362 (= G352), G385 (= G375)
- binding adenosine-5'-diphosphate: G202 (= G193), A203 (= A194), K204 (= K195), K208 (= K199), G226 (= G217), G227 (= G218), N325 (= N314), P327 (= P316), G329 (= G318), V330 (≠ A319), E332 (= E321), G361 (= G351), D363 (= D353), T364 (= T354)
- binding trifluoromagnesate: K204 (= K195), K208 (= K199), G361 (= G351), G384 (= G374), G385 (= G375)
2paaA Crystal structure of phosphoglycerate kinase-2 bound to atp and 3pg (see paper)
44% identity, 94% coverage: 4:392/415 of query aligns to 4:410/413 of 2paaA
- active site: R35 (= R35), K212 (= K195), G370 (= G352), G393 (= G375)
- binding adenosine-5'-triphosphate: G210 (= G193), A211 (= A194), K216 (= K199), G235 (= G218), L253 (= L235), G309 (≠ I290), L310 (= L291), G334 (= G315), G337 (= G318), V338 (≠ A319), E340 (= E321), D371 (= D353)
4axxA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp 3-phosphoglycerate and beryllium trifluoride
45% identity, 94% coverage: 4:392/415 of query aligns to 6:404/407 of 4axxA
- active site: R37 (= R35), K206 (= K195), G364 (= G352), G387 (= G375)
- binding adenosine-5'-diphosphate: G204 (= G193), A205 (= A194), K210 (= K199), G228 (= G217), G229 (= G218), N327 (= N314), P329 (= P316), G331 (= G318), V332 (≠ A319), E334 (= E321), G363 (= G351), G364 (= G352), D365 (= D353), T366 (= T354)
- binding beryllium trifluoride ion: K206 (= K195), K210 (= K199), G363 (= G351)
2x15A The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp and 1,3- bisphosphoglycerate
45% identity, 94% coverage: 4:392/415 of query aligns to 6:405/408 of 2x15A
- active site: R37 (= R35), K207 (= K195), G365 (= G352), G388 (= G375)
- binding adenosine-5'-diphosphate: G205 (= G193), A206 (= A194), K207 (= K195), K211 (= K199), G229 (= G217), G230 (= G218), N328 (= N314), P330 (= P316), G332 (= G318), V333 (≠ A319), E335 (= E321), G364 (= G351), G365 (= G352), D366 (= D353), T367 (= T354)
- binding adenosine-5'-triphosphate: G205 (= G193), A206 (= A194), K207 (= K195), K211 (= K199), G229 (= G217), G230 (= G218), N328 (= N314), G332 (= G318), V333 (≠ A319), E335 (= E321), G364 (= G351), G365 (= G352), D366 (= D353), T367 (= T354), G387 (= G374), G388 (= G375)
- binding 1,3-bisphosphoglyceric acid: D22 (= D20), N24 (= N22), R37 (= R35), H61 (= H58), R64 (= R61), R121 (= R116), R162 (= R149), K207 (= K195), K211 (= K199), G364 (= G351), G387 (= G374), G388 (= G375)
2wzdA The catalytically active fully closed conformation of human phosphoglycerate kinase k219a mutant in complex with adp, 3pg and aluminium trifluoride (see paper)
45% identity, 94% coverage: 4:392/415 of query aligns to 6:402/405 of 2wzdA
- active site: R37 (= R35), K204 (= K195), G362 (= G352), G385 (= G375)
- binding adenosine-5'-diphosphate: G202 (= G193), A203 (= A194), K204 (= K195), G226 (= G217), G227 (= G218), N325 (= N314), P327 (= P316), G329 (= G318), V330 (≠ A319), E332 (= E321), G361 (= G351), D363 (= D353), T364 (= T354)
- binding aluminum fluoride: R37 (= R35), K204 (= K195), G361 (= G351), G362 (= G352), G384 (= G374)
4o33A Crystal structure of human pgk1 3pg and terazosin(tzn) ternary complex (see paper)
44% identity, 94% coverage: 4:392/415 of query aligns to 8:414/417 of 4o33A
- active site: R39 (= R35), K216 (= K195), G374 (= G352), G397 (= G375)
- binding [4-(4-amino-6,7-dimethoxyquinazolin-2-yl)piperazin-1-yl][(2R)-tetrahydrofuran-2-yl]methanone: G238 (= G217), G239 (= G218), T255 (≠ K233), L257 (= L235), F292 (= F270), M312 (= M289), G313 (≠ I290), L314 (= L291), G341 (= G318), V342 (≠ A319)
Query Sequence
>WP_043743254.1 NCBI__GCF_000009985.1:WP_043743254.1
MFRTIDKLDVQGKRVLVRADLNVPAKDGKVTDTTRIDRSAATLIQLAAKGAKVIVLTHFG
RPKGREDKYSQKLLVEPLAKAVGKAVAWADDCIGPDVEKLIASMKDGDIALLENVRFHPE
EEKNDPAFAKALAALGDAYVNDAFSTAHRAHASTEGLAHLLPAAAGRLMQAELEALGKAL
EAPEKPVAAIVGGAKVSTKLDLLGNLVSKVDYLIIGGGMANTFLFAQGKQVGKSLCEKDL
ADTARAILEKAKEAKCHIVLPVDAVVAGEFAENAANEVVSVDAVPADKMILDAGPASAEA
IIDRLGGCKTLVWNGPLGAFEIAPFDKATNAVAQWAAERTLQGKLLTVGGGGDTVSALAK
AGVEEKFSYISTAGGAFLEWLEGKELPGVAALHVQPEQVRGTGCGCGAGGAGGCG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory