SitesBLAST
Comparing WP_043743342.1 NCBI__GCF_000009985.1:WP_043743342.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
28% identity, 99% coverage: 3:259/260 of query aligns to 4:257/259 of 5zaiC
- active site: A65 (≠ G64), F70 (≠ T69), S82 (= S81), R86 (≠ M85), G110 (≠ M112), E113 (≠ G115), P132 (= P134), E133 (= E135), I138 (vs. gap), P140 (= P141), G141 (≠ P142), A226 (≠ M227), F236 (≠ R238)
- binding coenzyme a: K24 (≠ L23), L25 (≠ H24), A63 (= A62), G64 (= G63), A65 (≠ G64), D66 (= D65), I67 (= I66), P132 (= P134), R166 (= R167), F248 (≠ L250), K251 (= K253)
Q4WF54 Mevalonyl-coenzyme A hydratase sidH; Siderophore biosynthesis protein H; EC 4.2.1.- from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
28% identity, 99% coverage: 1:258/260 of query aligns to 1:265/270 of Q4WF54
Sites not aligning to the query:
- 268:270 PTS1-type peroxisomal targeting signal
2uzfA Crystal structure of staphylococcus aureus 1,4-dihydroxy-2-naphthoyl coa synthase (menb) in complex with acetoacetyl coa (see paper)
28% identity, 98% coverage: 3:258/260 of query aligns to 8:253/260 of 2uzfA
- active site: G70 (= G64), R80 (= R82), L84 (≠ M85), G108 (≠ M112), V111 (≠ G115), T130 (≠ P134), G131 (≠ E135), S136 (vs. gap), D138 (≠ P141), A139 (≠ P142), A225 (vs. gap), Y233 (= Y229)
- binding acetoacetyl-coenzyme a: V28 (≠ L23), R29 (≠ H24), S68 (≠ A62), G69 (= G63), G70 (= G64), D71 (= D65), Y104 (≠ A108), G108 (≠ M112)
6l3pA Crystal strcuture of feruloyl-coa hydratase lyase(fchl) complexed with coa
30% identity, 81% coverage: 5:215/260 of query aligns to 10:218/244 of 6l3pA
- active site: M69 (≠ G64), Y74 (≠ W68), R86 (= R82), Q90 (= Q86), G114 (≠ M112), S117 (≠ G115), S136 (≠ P134), E137 (= E135), I142 (≠ F140), P144 (= P142), G145 (vs. gap)
- binding coenzyme a: K28 (≠ L23), R29 (≠ H24), A31 (= A26), A67 (= A62), M69 (≠ G64), D70 (= D65), L71 (≠ I66), G113 (= G111)
Sites not aligning to the query:
3rrvB Crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium paratuberculosis (see paper)
31% identity, 70% coverage: 1:182/260 of query aligns to 4:185/254 of 3rrvB
Sites not aligning to the query:
Q5HH38 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Staphylococcus aureus (strain COL) (see paper)
28% identity, 98% coverage: 3:258/260 of query aligns to 13:266/273 of Q5HH38
- R34 (≠ H24) binding in other chain
- SGGDQ 73:77 (≠ AGGDI 62:66) binding in other chain
- S149 (vs. gap) binding in other chain
2vssD Wild-type hydroxycinnamoyl-coa hydratase lyase in complex with acetyl- coa and vanillin (see paper)
29% identity, 80% coverage: 5:211/260 of query aligns to 9:218/246 of 2vssD
- active site: M68 (≠ G64), Y73 (≠ A71), D78 (= D76), R90 (= R82), Q94 (= Q86), G118 (≠ M112), S121 (≠ G115), S140 (≠ P134), E141 (= E135), I146 (≠ F140), P148 (= P142), G149 (vs. gap)
- binding acetyl coenzyme *a: E26 (= E22), K27 (≠ L23), R28 (≠ H24), A30 (= A26), A66 (= A62), M68 (≠ G64), D69 (= D65), L70 (≠ I66), F74 (≠ M72), W114 (≠ A108), F116 (≠ L110), S140 (≠ P134)
- binding 4-hydroxy-3-methoxybenzaldehyde: M68 (≠ G64), Y73 (≠ A71), F74 (≠ M72), Q96 (≠ A88), E141 (= E135), G149 (vs. gap), N150 (≠ T143)
Sites not aligning to the query:
2vssB Wild-type hydroxycinnamoyl-coa hydratase lyase in complex with acetyl- coa and vanillin (see paper)
29% identity, 80% coverage: 5:211/260 of query aligns to 8:217/247 of 2vssB
- active site: M67 (≠ G64), Y72 (≠ A71), D77 (= D76), R89 (= R82), Q93 (= Q86), G117 (≠ M112), S120 (≠ G115), S139 (≠ P134), E140 (= E135), I145 (≠ F140), P147 (= P142), G148 (vs. gap)
- binding acetyl coenzyme *a: E25 (= E22), K26 (≠ L23), R27 (≠ H24), A29 (= A26), A65 (= A62), M67 (≠ G64), D68 (= D65), W113 (≠ A108), F115 (≠ L110), G117 (≠ M112), S139 (≠ P134), E140 (= E135)
Sites not aligning to the query:
O69762 Hydroxycinnamoyl-CoA hydratase-lyase; HCHL; P-hydroxycinnamoyl CoA hydratase/lyase; Trans-feruloyl-CoA hydratase/vanillin synthase; EC 4.1.2.61 from Pseudomonas fluorescens (see 2 papers)
29% identity, 80% coverage: 5:211/260 of query aligns to 11:220/276 of O69762
- K29 (≠ L23) binding
- A68 (= A62) binding
- M70 (≠ G64) binding
- L72 (≠ I66) binding
- Y75 (≠ A71) binding
- G120 (≠ M112) binding
- S123 (≠ G115) mutation to A: Reduced kcat compared to wild-type but not markerdly.
- S142 (≠ P134) binding
- E143 (= E135) mutation to A: Abolishes catalytic activity.
- W146 (≠ A138) binding
- G151 (vs. gap) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 239 binding ; Y→F: Increased KM for feruloyl-CoA but retains a significant amount of catalytic activity with a kcat 10 times less than that of the wild-type.
Q8GYN9 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal; DHNS; Enoyl-CoA hydratase/isomerase D; ECHID; Naphthoate synthase; EC 4.1.3.36 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 95% coverage: 12:259/260 of query aligns to 86:331/337 of Q8GYN9
Sites not aligning to the query:
- 20 H→V: Loss of peroxisomal targeting.
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
28% identity, 96% coverage: 10:258/260 of query aligns to 14:257/260 of 1dubA
- active site: A68 (≠ G64), M73 (≠ T69), S83 (≠ A84), L87 (≠ A88), G111 (≠ M112), E114 (≠ G115), P133 (= P134), E134 (= E135), T139 (vs. gap), P141 (= P141), G142 (≠ P142), K227 (vs. gap), F237 (≠ R238)
- binding acetoacetyl-coenzyme a: K26 (≠ E22), A27 (≠ L23), L28 (≠ H24), A30 (= A26), A66 (= A62), A68 (≠ G64), D69 (= D65), I70 (= I66), Y107 (≠ A108), G110 (= G111), G111 (≠ M112), E114 (≠ G115), P133 (= P134), E134 (= E135), L137 (≠ A138), G142 (≠ P142), F233 (= F234), F249 (≠ L250)
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
28% identity, 96% coverage: 10:258/260 of query aligns to 12:255/258 of 1ey3A
- active site: A66 (≠ G64), M71 (≠ T69), S81 (≠ A84), L85 (≠ A88), G109 (≠ M112), E112 (≠ G115), P131 (= P134), E132 (= E135), T137 (vs. gap), P139 (= P141), G140 (≠ P142), K225 (vs. gap), F235 (≠ R238)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (≠ E22), L26 (≠ H24), A28 (= A26), A64 (= A62), G65 (= G63), A66 (≠ G64), D67 (= D65), I68 (= I66), L85 (≠ A88), W88 (≠ L91), G109 (≠ M112), P131 (= P134), L135 (≠ A138), G140 (≠ P142)
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
28% identity, 96% coverage: 10:258/260 of query aligns to 44:287/290 of P14604
- E144 (≠ G115) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (= E135) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
28% identity, 96% coverage: 10:258/260 of query aligns to 13:251/254 of 2dubA
- active site: A67 (≠ G64), M72 (≠ E79), S82 (≠ V89), G105 (≠ M112), E108 (≠ G115), P127 (= P134), E128 (= E135), T133 (vs. gap), P135 (= P141), G136 (≠ P142), K221 (vs. gap), F231 (≠ R238)
- binding octanoyl-coenzyme a: K25 (≠ E22), A26 (≠ L23), L27 (≠ H24), A29 (= A26), A65 (= A62), A67 (≠ G64), D68 (= D65), I69 (= I66), K70 (≠ A77), G105 (≠ M112), E108 (≠ G115), P127 (= P134), E128 (= E135), G136 (≠ P142), A137 (≠ T143)
Q7CQ56 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
27% identity, 99% coverage: 2:259/260 of query aligns to 23:279/285 of Q7CQ56
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
29% identity, 96% coverage: 10:258/260 of query aligns to 14:255/258 of 1mj3A
- active site: A68 (≠ G64), M73 (≠ T69), S83 (= S83), L85 (≠ M85), G109 (≠ M112), E112 (≠ G115), P131 (= P134), E132 (= E135), T137 (vs. gap), P139 (= P141), G140 (≠ P142), K225 (vs. gap), F235 (≠ R238)
- binding hexanoyl-coenzyme a: K26 (≠ E22), A27 (≠ L23), L28 (≠ H24), A30 (= A26), A66 (= A62), G67 (= G63), A68 (≠ G64), D69 (= D65), I70 (= I66), G109 (≠ M112), P131 (= P134), E132 (= E135), L135 (≠ A138), G140 (≠ P142)
3h02A 2.15 angstrom resolution crystal structure of naphthoate synthase from salmonella typhimurium.
26% identity, 99% coverage: 2:259/260 of query aligns to 19:260/266 of 3h02A
- active site: G82 (= G64), H86 (≠ A84), L90 (≠ A88), G114 (≠ M112), V117 (≠ G115), G137 (≠ E135), S142 (vs. gap), D144 (≠ P141), G145 (≠ P142), A231 (≠ M227), Y239 (≠ V235)
- binding bicarbonate ion: G113 (= G111), Q135 (≠ L133), G137 (≠ E135), W165 (≠ V162)
4elxA Structure of apo e.Coli. 1,4-dihydroxy-2- naphthoyl coa synthases with cl (see paper)
26% identity, 98% coverage: 6:259/260 of query aligns to 24:262/268 of 4elxA
- active site: G83 (= G64), H88 (≠ T69), L92 (= L73), G116 (≠ M112), V119 (≠ G115), G139 (≠ E135), S144 (vs. gap), D146 (≠ P141), G147 (≠ P142), A233 (≠ M227), Y241 (≠ V235)
- binding chloride ion: G115 (= G111), G139 (≠ E135), W167 (≠ V162)
3t88A Crystal structure of escherichia coli menb in complex with substrate analogue, osb-ncoa (see paper)
26% identity, 98% coverage: 6:259/260 of query aligns to 23:275/281 of 3t88A
- active site: G82 (= G64), R87 (= R70), Y93 (≠ D76), H101 (≠ A84), L105 (≠ A88), G129 (≠ M112), V132 (≠ G115), G152 (≠ E135), S157 (vs. gap), D159 (≠ P141), G160 (≠ P142), A246 (≠ M227), Y254 (≠ V235)
- binding o-succinylbenzoyl-N-coenzyme A: Q39 (≠ E22), V40 (≠ L23), R41 (≠ H24), A43 (= A26), S80 (≠ A62), G81 (= G63), G82 (= G64), D83 (= D65), Q84 (≠ I66), K85 (≠ G67), Y93 (≠ D76), V104 (≠ M87), L105 (≠ A88), Y125 (≠ A108), G129 (≠ M112), T151 (≠ P134), V155 (≠ A138), F158 (= F140), D159 (≠ P141), T250 (≠ V231), Y254 (≠ V235), F266 (≠ L250), K269 (= K253)
4i42A E.Coli. 1,4-dihydroxy-2-naphthoyl coenzyme a synthase (ecmenb) in complex with 1-hydroxy-2-naphthoyl-coa (see paper)
26% identity, 98% coverage: 6:259/260 of query aligns to 27:279/285 of 4i42A
- active site: G86 (= G64), R91 (= R70), Y97 (≠ D76), H105 (≠ A84), L109 (≠ A88), G133 (≠ M112), V136 (≠ G115), G156 (≠ E135), S161 (vs. gap), D163 (≠ P141), G164 (≠ P142), A250 (≠ M227), Y258 (≠ V235)
- binding 1-hydroxy-2-naphthoyl-CoA: V44 (≠ L23), R45 (≠ H24), S84 (≠ A62), G85 (= G63), G86 (= G64), D87 (= D65), Q88 (≠ I66), K89 (≠ G67), Y97 (≠ D76), V108 (≠ M87), Y129 (≠ A108), G133 (≠ M112), T155 (≠ P134), S161 (vs. gap), T254 (≠ V231), F270 (≠ L250), K273 (= K253)
Query Sequence
>WP_043743342.1 NCBI__GCF_000009985.1:WP_043743342.1
MTDHIHVKISGAVATVTLRRPELHNALDEQMVGNLAQTFQKLSVAEAVRVVVIEGQGPSF
CAGGDIGWTRAMLDQDAEEVSRSAMQMAVMLDAIDRCAKPVIARVQGAALGMGAGIVSVA
DMVVAADDSSFSLPEVRAGFPPTLIMPYLAAAMGTRAMRRYVLSGERFDAREALRLGLIH
AVVAGDKLDSARDLMVESCLKGAPKAQGAAKDMLRVVDDSPAGPDLMRYTVAQFVDARAG
AECREGVLALTEKRKPNWSV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory