SitesBLAST
Comparing WP_043743639.1 AMB_RS06625 (2Fe-2S)-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1sb3C Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
48% identity, 85% coverage: 17:160/169 of query aligns to 5:147/161 of 1sb3C
- binding fe2/s2 (inorganic) cluster: Q39 (≠ L52), C41 (= C54), G44 (= G57), C46 (= C59), G47 (= G60), C49 (= C62), C61 (= C74), C100 (= C113), G101 (= G114), C103 (= C116), C135 (= C148), C137 (= C150)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q112), C137 (= C150)
1dgjA Crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 (see paper)
44% identity, 86% coverage: 18:163/169 of query aligns to 5:152/906 of 1dgjA
- binding fe2/s2 (inorganic) cluster: V38 (≠ L52), G39 (= G53), C40 (= C54), G41 (= G55), G43 (= G57), Q44 (≠ E58), C45 (= C59), G46 (= G60), C48 (= C62), R58 (= R72), C60 (= C74), C100 (= C113), G101 (= G114), C103 (= C116), C137 (= C148), C139 (= C150)
- binding pterin cytosine dinucleotide: Q99 (= Q112), C139 (= C150)
Sites not aligning to the query:
- active site: 391, 427, 503, 507, 535, 869, 870
- binding molybdenum (iv)oxide: 424, 535, 698, 869
- binding pterin cytosine dinucleotide: 423, 424, 535, 652, 655, 656, 657, 658, 697, 698, 700, 702, 703, 799, 800, 803, 804, 807, 865, 866, 867, 868, 869
4zohC Crystal structure of glyceraldehyde oxidoreductase (see paper)
39% identity, 93% coverage: 10:166/169 of query aligns to 5:159/161 of 4zohC
- binding fe2/s2 (inorganic) cluster: C47 (= C54), S50 (≠ G57), C52 (= C59), G53 (= G60), C55 (= C62), C67 (= C74), C106 (= C113), G107 (= G114), C109 (= C116), C141 (= C148), C143 (= C150)
- binding pterin cytosine dinucleotide: Q105 (= Q112), C143 (= C150)
1ffuD Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
41% identity, 87% coverage: 17:163/169 of query aligns to 5:150/156 of 1ffuD
- binding fe2/s2 (inorganic) cluster: C41 (= C54), S44 (≠ G57), H45 (≠ E58), C46 (= C59), G47 (= G60), C49 (= C62), C61 (= C74), C100 (= C113), G101 (= G114), C103 (= C116), C135 (= C148), C137 (= C150)
1ffvA Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
41% identity, 87% coverage: 17:163/169 of query aligns to 4:149/155 of 1ffvA
- binding fe2/s2 (inorganic) cluster: I38 (≠ L52), C40 (= C54), S43 (≠ G57), C45 (= C59), G46 (= G60), C48 (= C62), C60 (= C74), C99 (= C113), G100 (= G114), C102 (= C116), C134 (= C148), C136 (= C150)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q98 (= Q112), C136 (= C150)
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
43% identity, 88% coverage: 16:163/169 of query aligns to 3:152/907 of 4usaA
- binding fe2/s2 (inorganic) cluster: V38 (≠ L52), C40 (= C54), E41 (≠ G55), G43 (= G57), C45 (= C59), G46 (= G60), C48 (= C62), R58 (= R72), C60 (= C74), C100 (= C113), G101 (= G114), C103 (= C116), C137 (= C148), C139 (= C150)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q112), C139 (= C150)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 531, 532, 535, 539
- binding hydrocinnamic acid: 255, 425, 494, 497, 535, 626
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
43% identity, 88% coverage: 16:163/169 of query aligns to 3:152/907 of 4us9A
- binding fe2/s2 (inorganic) cluster: V38 (≠ L52), C40 (= C54), E41 (≠ G55), G43 (= G57), C45 (= C59), G46 (= G60), C48 (= C62), R58 (= R72), C60 (= C74), C100 (= C113), G101 (= G114), C103 (= C116), C137 (= C148), C139 (= C150)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q112), C139 (= C150)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 3-phenylpropanal: 255, 257, 258, 752
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
43% identity, 88% coverage: 16:163/169 of query aligns to 3:152/907 of 4us8A
- binding fe2/s2 (inorganic) cluster: V38 (≠ L52), C40 (= C54), E41 (≠ G55), G43 (= G57), C45 (= C59), G46 (= G60), C48 (= C62), R58 (= R72), C60 (= C74), C100 (= C113), G101 (= G114), C103 (= C116), C137 (= C148), C139 (= C150)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q112), C139 (= C150)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539
- binding benzaldehyde: 255, 255, 394, 425, 425, 425, 425, 497, 497, 501, 531, 535, 535, 626, 626, 626, 694, 696, 697
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
43% identity, 88% coverage: 16:163/169 of query aligns to 3:152/907 of 4c7yA
- binding fe2/s2 (inorganic) cluster: C40 (= C54), E41 (≠ G55), G43 (= G57), C45 (= C59), G46 (= G60), C48 (= C62), R58 (= R72), C60 (= C74), C100 (= C113), G101 (= G114), C103 (= C116), C137 (= C148), C139 (= C150)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q112), C139 (= C150)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 535, 539
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
- binding hydrogen peroxide: 696, 697, 869
3fc4A Ethylene glycol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
43% identity, 88% coverage: 16:163/169 of query aligns to 3:152/907 of 3fc4A
- binding fe2/s2 (inorganic) cluster: V38 (≠ L52), C40 (= C54), E41 (≠ G55), G43 (= G57), C45 (= C59), G46 (= G60), C48 (= C62), R58 (= R72), C60 (= C74), C100 (= C113), G101 (= G114), C103 (= C116), C137 (= C148), C139 (= C150)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q112), C139 (= C150)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 1,2-ethanediol: 535, 622, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
3fahA Glycerol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
43% identity, 88% coverage: 16:163/169 of query aligns to 3:152/907 of 3fahA
- binding fe2/s2 (inorganic) cluster: V38 (≠ L52), C40 (= C54), E41 (≠ G55), G43 (= G57), C45 (= C59), G46 (= G60), C48 (= C62), R58 (= R72), C60 (= C74), C100 (= C113), G101 (= G114), C103 (= C116), C137 (= C148), C139 (= C150)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q112), C139 (= C150)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding glycerol: 416, 535, 622, 683, 696, 697, 869, 884, 889, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
1sijA Crystal structure of the aldehyde dehydrogenase (a.K.A. Aor or mop) of desulfovibrio gigas covalently bound to [aso3]- (see paper)
43% identity, 88% coverage: 16:163/169 of query aligns to 3:152/907 of 1sijA
- binding fe2/s2 (inorganic) cluster: V38 (≠ L52), C40 (= C54), E41 (≠ G55), G43 (= G57), C45 (= C59), G46 (= G60), C48 (= C62), R58 (= R72), C60 (= C74), Q99 (= Q112), C100 (= C113), G101 (= G114), C103 (= C116), C137 (= C148), C139 (= C150)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q112), C139 (= C150)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding arsenite: 535, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 698, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
Q46509 Aldehyde oxidoreductase; Molybdenum iron sulfur protein; EC 1.2.99.7 from Megalodesulfovibrio gigas (Desulfovibrio gigas) (see paper)
43% identity, 88% coverage: 16:163/169 of query aligns to 3:152/907 of Q46509
- C40 (= C54) binding
- C45 (= C59) binding
- C48 (= C62) binding
- C60 (= C74) binding
- C100 (= C113) binding
- C103 (= C116) binding
- C137 (= C148) binding
- C139 (= C150) binding
1t3qA Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
42% identity, 86% coverage: 16:160/169 of query aligns to 5:148/162 of 1t3qA
- binding fe2/s2 (inorganic) cluster: I40 (≠ L52), C42 (= C54), E43 (≠ G55), G45 (= G57), C47 (= C59), G48 (= G60), C50 (= C62), R60 (= R72), C62 (= C74), C101 (= C113), G102 (= G114), C104 (= C116), C136 (= C148), C138 (= C150)
- binding pterin cytosine dinucleotide: Q100 (= Q112), C138 (= C150)
8gy3B Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
43% identity, 82% coverage: 31:168/169 of query aligns to 16:152/154 of 8gy3B
- binding fe2/s2 (inorganic) cluster: G38 (= G53), C39 (= C54), G40 (= G55), G42 (= G57), C44 (= C59), G45 (= G60), C47 (= C62), C59 (= C74), C97 (= C113), C100 (= C116), Q101 (≠ T117), C132 (= C148), C134 (= C150)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q96 (= Q112), C134 (= C150)
5y6qA Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
43% identity, 87% coverage: 17:163/169 of query aligns to 5:151/157 of 5y6qA
- binding fe2/s2 (inorganic) cluster: G40 (= G53), C41 (= C54), D42 (≠ G55), G44 (= G57), C46 (= C59), G47 (= G60), C49 (= C62), C61 (= C74), C101 (= C113), G102 (= G114), C104 (= C116), C136 (= C148), C138 (= C150)
- binding pterin cytosine dinucleotide: Q100 (= Q112), C138 (= C150)
P19921 Carbon monoxide dehydrogenase small chain; CO dehydrogenase subunit S; CO-DH S; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
38% identity, 90% coverage: 15:166/169 of query aligns to 4:155/166 of P19921
- C42 (= C54) binding
- C47 (= C59) binding
- C50 (= C62) binding
- C62 (= C74) binding
- C102 (= C113) binding
- C105 (= C116) binding
- C137 (= C148) binding
- C139 (= C150) binding
1n5wD Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
38% identity, 90% coverage: 15:166/169 of query aligns to 2:153/158 of 1n5wD
- binding flavin-adenine dinucleotide: S43 (≠ G57), H44 (≠ E58)
- binding fe2/s2 (inorganic) cluster: C40 (= C54), S43 (≠ G57), C45 (= C59), G46 (= G60), C48 (= C62), C60 (= C74), C100 (= C113), G101 (= G114), C103 (= C116), C135 (= C148), C137 (= C150)
- binding pterin cytosine dinucleotide: Q99 (= Q112), C137 (= C150)
1n5wA Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
38% identity, 90% coverage: 15:166/169 of query aligns to 2:153/161 of 1n5wA
- binding flavin-adenine dinucleotide: S43 (≠ G57), H44 (≠ E58)
- binding fe2/s2 (inorganic) cluster: I38 (≠ L52), G39 (= G53), C40 (= C54), S43 (≠ G57), C45 (= C59), G46 (= G60), C48 (= C62), C60 (= C74), C100 (= C113), G101 (= G114), C103 (= C116), C135 (= C148), C137 (= C150)
3hrdD Crystal structure of nicotinate dehydrogenase (see paper)
39% identity, 89% coverage: 17:166/169 of query aligns to 6:154/160 of 3hrdD
- binding flavin-adenine dinucleotide: E44 (≠ K56), G45 (= G57), E46 (= E58)
- binding fe2/s2 (inorganic) cluster: E40 (≠ L52), C42 (= C54), S43 (≠ G55), G45 (= G57), C47 (= C59), G48 (= G60), C50 (= C62), C62 (= C74), Q100 (= Q112), C101 (= C113), G102 (= G114), C104 (= C116), C136 (= C148), C138 (= C150)
- binding pterin cytosine dinucleotide: Q100 (= Q112), C138 (= C150)
Query Sequence
>WP_043743639.1 AMB_RS06625 (2Fe-2S)-binding protein
MAGKPATAAKAKSPAQLSLTVNGTERRAALADGDMPLVYWLREELGLTGTHLGCGKGECG
ACTVLIDGQPARSCRTTLGEAAGKVVTTIEGLGTPEAPHPVQAAFVEEQAAQCGFCTPGM
VVEGAALLARTAQPDLAEVKEALDGHLCRCGSHQRVLKAVMRAGGRDKS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory